| parent folder | - | - |
| - | "Ta-daa!" ❤️.json | 11093 | 2023-08-02 10:26:46 |
| - | "Ta-daa!" ❤️[0].png | 767494 | 2023-08-02 10:26:46 |
| - | "Ta-daa!" ❤️[1].png | 778829 | 2023-08-02 10:26:46 |
| - | "Ta-daa!" ❤️[2].png | 811045 | 2023-08-02 10:26:46 |
| - | "Today's the day I find that hero" ❤️.json | 15514 | 2023-08-02 10:26:27 |
| - | "Today's the day I find that hero" ❤️[0].png | 854924 | 2023-08-02 10:26:26 |
| - | "Today's the day I find that hero" ❤️[1].png | 867136 | 2023-08-02 10:26:26 |
| - | "Today's the day I find that hero" ❤️[2].png | 889267 | 2023-08-02 10:26:26 |
| - | "Today's the day I find that hero" ❤️[3].png | 866073 | 2023-08-02 10:26:27 |
| - | "Today's the day I find that hero" ❤️[4].png | 908720 | 2023-08-02 10:26:27 |
| - | (=ↀωↀ=).json | 7035 | 2018-11-28 17:46:13 |
| - | (=ↀωↀ=).png | 396192 | 2018-11-28 17:46:13 |
| - | 1078617_MatoSpectoru_midna_anal_18__2014_b__acoplado__b__edit_ps__sai_edit_lr_no_faces_version_2.json | 9332 | 2025-04-26 21:06:16 |
| - | 1078617_MatoSpectoru_midna_anal_18__2014_b__acoplado__b__edit_ps__sai_edit_lr_no_faces_version_2.png | 342737 | 2025-04-26 21:06:16 |
| - | 1085850_MatoSpectoru_ruto_2015_color_ps_c.json | 10501 | 2025-04-26 23:03:58 |
| - | 1085850_MatoSpectoru_ruto_2015_color_ps_c.png | 796578 | 2025-04-26 23:03:58 |
| - | 1086674_MatoSpectoru_ruto_2015_color_ps_c_nipple_version.json | 10501 | 2025-04-26 23:03:59 |
| - | 1086674_MatoSpectoru_ruto_2015_color_ps_c_nipple_version.png | 800928 | 2025-04-26 23:03:59 |
| - | 1092109_MatoSpectoru_gardevoir___gothitelle_lr.json | 7299 | 2025-04-27 00:39:33 |
| - | 1092109_MatoSpectoru_gardevoir___gothitelle_lr.png | 242475 | 2025-04-27 00:39:33 |
| - | 1093824_MatoSpectoru_blaze_the_cat_2015_colorc_ps_lrb.json | 7872 | 2025-04-27 01:04:12 |
| - | 1093824_MatoSpectoru_blaze_the_cat_2015_colorc_ps_lrb.png | 867542 | 2025-04-27 01:04:12 |
| - | 1094602_MatoSpectoru_vanilla_the_rabbit_ps_lr_said.json | 8086 | 2025-04-27 01:16:33 |
| - | 1094602_MatoSpectoru_vanilla_the_rabbit_ps_lr_said.png | 1763232 | 2025-04-27 01:16:33 |
| - | 1277104_MatoSpectoru_midna_blow_ps_lrb2.json | 6175 | 2025-04-29 00:53:53 |
| - | 1277104_MatoSpectoru_midna_blow_ps_lrb2.png | 656716 | 2025-04-29 00:53:53 |
| - | 1277480_MatoSpectoru_gardevoir___gothitelle_part_3_lrc2.json | 6602 | 2025-04-29 01:00:28 |
| - | 1277480_MatoSpectoru_gardevoir___gothitelle_part_3_lrc2.png | 553650 | 2025-04-29 01:00:28 |
| - | 1362088_MatoSpectoru_midna_sketch_3_wipb_retouch_sai_b_lr_no_cum_2b.json | 10814 | 2025-04-30 23:06:33 |
| - | 1362088_MatoSpectoru_midna_sketch_3_wipb_retouch_sai_b_lr_no_cum_2b.png | 498387 | 2025-04-30 23:06:33 |
| - | 1362091_MatoSpectoru_midna_sketch_3_wipb_retouch_sai_b_lr_cum_2b.json | 10814 | 2025-04-30 23:06:33 |
| - | 1362091_MatoSpectoru_midna_sketch_3_wipb_retouch_sai_b_lr_cum_2b.png | 503168 | 2025-04-30 23:06:33 |
| - | 1444706_MatoSpectoru_weavile_a_ps_f_2lr.json | 5277 | 2025-05-01 20:23:52 |
| - | 1444706_MatoSpectoru_weavile_a_ps_f_2lr.png | 330091 | 2025-05-01 20:23:52 |
| - | 1445750_MatoSpectoru_wendy_nsfw__e__ps_reoutchb_sai.json | 6227 | 2025-05-01 20:39:12 |
| - | 1445750_MatoSpectoru_wendy_nsfw__e__ps_reoutchb_sai.png | 468823 | 2025-05-01 20:39:12 |
| - | 1455570_MatoSpectoru_gatomon_color_sktch_f_pslrb2.json | 6202 | 2025-05-01 23:13:00 |
| - | 1455570_MatoSpectoru_gatomon_color_sktch_f_pslrb2.png | 514157 | 2025-05-01 23:13:00 |
| - | 1457007_MatoSpectoru_rougexwerehog_sktch_comm_f_lrb_retouchfinal.json | 12190 | 2025-05-01 23:31:35 |
| - | 1457007_MatoSpectoru_rougexwerehog_sktch_comm_f_lrb_retouchfinal.png | 341926 | 2025-05-01 23:31:35 |
| - | 1457008_MatoSpectoru_rougexwerehog_sktch_comm_cum_f_lrb_retouch_final.json | 12190 | 2025-05-01 23:31:35 |
| - | 1457008_MatoSpectoru_rougexwerehog_sktch_comm_cum_f_lrb_retouch_final.png | 344835 | 2025-05-01 23:31:35 |
| - | 1460074_MatoSpectoru_rouge_buttjob_fvgs__e__ps_lr.json | 9868 | 2025-05-02 00:19:45 |
| - | 1460074_MatoSpectoru_rouge_buttjob_fvgs__e__ps_lr.png | 348285 | 2025-05-02 00:19:45 |
| - | 1460075_MatoSpectoru_rouge_buttjob_fvgs__e__ps_cum_lr.json | 9868 | 2025-05-02 00:19:46 |
| - | 1460075_MatoSpectoru_rouge_buttjob_fvgs__e__ps_cum_lr.png | 367656 | 2025-05-02 00:19:46 |
| - | 1460442_MatoSpectoru_sktch_rouge_comm_with_tail.json | 9162 | 2025-05-01 23:13:05 |
| - | 1460442_MatoSpectoru_sktch_rouge_comm_with_tail.png | 239708 | 2025-05-01 23:13:05 |
| - | 1460444_MatoSpectoru_sktch_rouge_comm_with_tail_cum.json | 9162 | 2025-05-01 23:13:05 |
| - | 1460444_MatoSpectoru_sktch_rouge_comm_with_tail_cum.png | 253992 | 2025-05-01 23:13:05 |
| - | 1463353_MatoSpectoru_taokaka_fvgs_f__e_nocumlr.json | 8841 | 2025-05-02 01:10:31 |
| - | 1463353_MatoSpectoru_taokaka_fvgs_f__e_nocumlr.png | 807630 | 2025-05-02 01:10:31 |
| - | 1463354_MatoSpectoru_taokaka_fvgs_f__e_cumlr.json | 8841 | 2025-05-02 01:10:31 |
| - | 1463354_MatoSpectoru_taokaka_fvgs_f__e_cumlr.png | 813993 | 2025-05-02 01:10:31 |
| - | 1464923_MatoSpectoru_midnacreampienipplesfinalsailr.json | 9914 | 2025-05-02 01:25:16 |
| - | 1464923_MatoSpectoru_midnacreampienipplesfinalsailr.png | 487662 | 2025-05-02 01:25:16 |
| - | 1464924_MatoSpectoru_midnacreampiefinalsailr.json | 9914 | 2025-05-02 01:25:17 |
| - | 1464924_MatoSpectoru_midnacreampiefinalsailr.png | 487008 | 2025-05-02 01:25:17 |
| - | 1465547_MatoSpectoru_testanimationrougepsb.gif | 199970 | 2025-05-02 01:39:01 |
| - | 1465547_MatoSpectoru_testanimationrougepsb.json | 6746 | 2025-05-02 01:39:01 |
| - | 1467340_MatoSpectoru_toriel_fvgs2__e_cspb_lr.json | 5912 | 2025-05-02 02:06:07 |
| - | 1467340_MatoSpectoru_toriel_fvgs2__e_cspb_lr.png | 697063 | 2025-05-02 02:06:07 |
| - | 1474288_MatoSpectoru_jennybatfccomm_a__e_-pssainocumlr.json | 9513 | 2025-05-02 03:52:15 |
| - | 1474288_MatoSpectoru_jennybatfccomm_a__e_-pssainocumlr.png | 603570 | 2025-05-02 03:52:15 |
| - | 1474291_MatoSpectoru_jennybatfccomm_a__e_-pssaicumlr.json | 9513 | 2025-05-02 03:52:15 |
| - | 1474291_MatoSpectoru_jennybatfccomm_a__e_-pssaicumlr.png | 624364 | 2025-05-02 03:52:15 |
| - | 1492772_MatoSpectoru_rouge-osiris-full-color-comm_a__e_nocumlr.json | 9726 | 2025-05-02 08:28:52 |
| - | 1492772_MatoSpectoru_rouge-osiris-full-color-comm_a__e_nocumlr.png | 495069 | 2025-05-02 08:28:52 |
| - | 1492773_MatoSpectoru_rouge-osiris-full-color-comm_a__e_cumlr.json | 9726 | 2025-05-02 08:28:53 |
| - | 1492773_MatoSpectoru_rouge-osiris-full-color-comm_a__e_cumlr.png | 507616 | 2025-05-02 08:28:53 |
| - | 1492776_MatoSpectoru_orikomicolorsketchcomm-_e_lrf2lrb.json | 5761 | 2025-05-02 08:28:56 |
| - | 1492776_MatoSpectoru_orikomicolorsketchcomm-_e_lrf2lrb.png | 481751 | 2025-05-02 08:28:56 |
| - | 1492780_MatoSpectoru_onistalmidnafullcolorcomm_a__e_lr.json | 5782 | 2025-05-02 08:29:01 |
| - | 1492780_MatoSpectoru_onistalmidnafullcolorcomm_a__e_lr.png | 400298 | 2025-05-02 08:29:01 |
| - | 1492785_MatoSpectoru_phaniva-the-principal-sketch-color-comm_a__e_ps_a2_blr.json | 6326 | 2025-05-02 08:29:05 |
| - | 1492785_MatoSpectoru_phaniva-the-principal-sketch-color-comm_a__e_ps_a2_blr.png | 451882 | 2025-05-02 08:29:05 |
| - | 1492788_MatoSpectoru_dusk-sketch-comm-_a_lr.json | 6009 | 2025-05-02 08:29:08 |
| - | 1492788_MatoSpectoru_dusk-sketch-comm-_a_lr.png | 193327 | 2025-05-02 08:29:08 |
| - | 1492789_MatoSpectoru_niu-swiftreed-tanuki-sketch-comm-_a_lr.json | 6086 | 2025-05-02 08:29:09 |
| - | 1492789_MatoSpectoru_niu-swiftreed-tanuki-sketch-comm-_a_lr.png | 302012 | 2025-05-02 08:29:09 |
| - | 1492791_MatoSpectoru_cocosketchcommflrb.json | 5750 | 2025-05-02 08:29:12 |
| - | 1492791_MatoSpectoru_cocosketchcommflrb.png | 155787 | 2025-05-02 08:29:12 |
| - | 1492900_MatoSpectoru_tokage-sketch-comm_a_lrb.json | 6311 | 2025-05-02 08:30:50 |
| - | 1492900_MatoSpectoru_tokage-sketch-comm_a_lrb.png | 292435 | 2025-05-02 08:30:50 |
| - | 1494568_MatoSpectoru_brunasketchcomm_a_lr_a_b.json | 6549 | 2025-05-02 08:48:41 |
| - | 1494568_MatoSpectoru_brunasketchcomm_a_lr_a_b.png | 228958 | 2025-05-02 08:48:41 |
| - | 1499818_MatoSpectoru_chuzinafullcolorf_a__e_pslr2.json | 5938 | 2025-05-02 10:29:52 |
| - | 1499818_MatoSpectoru_chuzinafullcolorf_a__e_pslr2.png | 507918 | 2025-05-02 10:29:52 |
| - | 1500162_MatoSpectoru_blazikenfullcolorcomm_a_01b_e_lrb3.json | 9598 | 2025-05-02 10:30:03 |
| - | 1500162_MatoSpectoru_blazikenfullcolorcomm_a_01b_e_lrb3.png | 629392 | 2025-05-02 10:30:03 |
| - | 1500163_MatoSpectoru_blazikenfullcolorcomm_a_02b_e_wetlrc3.json | 9598 | 2025-05-02 10:30:04 |
| - | 1500163_MatoSpectoru_blazikenfullcolorcomm_a_02b_e_wetlrc3.png | 664451 | 2025-05-02 10:30:04 |
| - | 1501875_MatoSpectoru_makoto-nanaya-full-color-comm-_a_2_e_pslrcumfcrop.json | 7282 | 2025-05-02 11:02:23 |
| - | 1501875_MatoSpectoru_makoto-nanaya-full-color-comm-_a_2_e_pslrcumfcrop.png | 314454 | 2025-05-02 11:02:23 |
| - | 1501878_MatoSpectoru_laylafullcolorcommf_e_lrnocumbcrop.json | 7068 | 2025-05-02 08:46:23 |
| - | 1501878_MatoSpectoru_laylafullcolorcommf_e_lrnocumbcrop.png | 146446 | 2025-05-02 08:46:23 |
| - | 1501881_MatoSpectoru_felicia_crop.json | 5850 | 2025-04-26 23:38:50 |
| - | 1501881_MatoSpectoru_felicia_crop.png | 340703 | 2025-04-26 23:38:50 |
| - | 1504743_MatoSpectoru_blazikenandocsketchcolorcomm_a__e_bsainocumlr.json | 11922 | 2025-05-02 11:53:46 |
| - | 1504743_MatoSpectoru_blazikenandocsketchcolorcomm_a__e_bsainocumlr.png | 748197 | 2025-05-02 11:53:46 |
| - | 1504745_MatoSpectoru_blazikenandocsketchcolorcomm_a__e_bsaicumlr.json | 11922 | 2025-05-02 11:53:47 |
| - | 1504745_MatoSpectoru_blazikenandocsketchcolorcomm_a__e_bsaicumlr.png | 789021 | 2025-05-02 11:53:47 |
| - | 1504746_MatoSpectoru_blazikenandocsketchcolorcomm_a__e_bsaicumnoface.json | 11922 | 2025-05-02 11:53:46 |
| - | 1504746_MatoSpectoru_blazikenandocsketchcolorcomm_a__e_bsaicumnoface.png | 750865 | 2025-05-02 11:53:46 |
| - | 1507530_MatoSpectoru_lilac-and-carol-comm01f-pscorrectionpsclrb.json | 10153 | 2025-05-02 12:41:38 |
| - | 1507530_MatoSpectoru_lilac-and-carol-comm01f-pscorrectionpsclrb.png | 702254 | 2025-05-02 12:41:38 |
| - | 1507531_MatoSpectoru_lilac-and-carol-comm02f-ps_blr.json | 10153 | 2025-05-02 12:41:38 |
| - | 1507531_MatoSpectoru_lilac-and-carol-comm02f-ps_blr.png | 726460 | 2025-05-02 12:41:38 |
| - | 1552212_MatoSpectoru_rougethewerebatxtailfccomm_e_fnocumblr.json | 15977 | 2025-05-02 23:23:35 |
| - | 1552212_MatoSpectoru_rougethewerebatxtailfccomm_e_fnocumblr.png | 705156 | 2025-05-02 23:23:35 |
| - | 1552213_MatoSpectoru_rougethewerebatxtailfccomm_e_fcumblr.json | 15977 | 2025-05-02 23:23:35 |
| - | 1552213_MatoSpectoru_rougethewerebatxtailfccomm_e_fcumblr.png | 716058 | 2025-05-02 23:23:35 |
| - | 1552215_MatoSpectoru_rougethewerebat2fccommf2psnocumblr.json | 15977 | 2025-05-02 23:23:35 |
| - | 1552215_MatoSpectoru_rougethewerebat2fccommf2psnocumblr.png | 600397 | 2025-05-02 23:23:35 |
| - | 1552217_MatoSpectoru_rougethewerebat2fccommf2pscumblr.json | 15977 | 2025-05-02 23:23:36 |
| - | 1552217_MatoSpectoru_rougethewerebat2fccommf2pscumblr.png | 605981 | 2025-05-02 23:23:36 |
| - | 1558517_MatoSpectoru_diggersbymilfflatcolorcommfhnohmnpsnocumlr.json | 13734 | 2025-05-03 01:03:32 |
| - | 1558517_MatoSpectoru_diggersbymilfflatcolorcommfhnohmnpsnocumlr.png | 673450 | 2025-05-03 01:03:32 |
| - | 1558519_MatoSpectoru_diggersbymilfflatcolorcommfhnohmnpscumlr.json | 13734 | 2025-05-03 01:03:32 |
| - | 1558519_MatoSpectoru_diggersbymilfflatcolorcommfhnohmnpscumlr.png | 684656 | 2025-05-03 01:03:32 |
| - | 1560537_MatoSpectoru_diggersbymilfflatcolorcommfhhmnpsnocumlr.json | 13734 | 2025-05-03 01:03:31 |
| - | 1560537_MatoSpectoru_diggersbymilfflatcolorcommfhhmnpsnocumlr.png | 675098 | 2025-05-03 01:03:31 |
| - | 1560540_MatoSpectoru_diggersbymilfflatcolorcommfhhmnpscumlr.json | 13734 | 2025-05-03 01:03:31 |
| - | 1560540_MatoSpectoru_diggersbymilfflatcolorcommfhhmnpscumlr.png | 684137 | 2025-05-03 01:03:31 |
| - | 1561002_MatoSpectoru_muffet-fvgc-f_e_psnocumlr.json | 9405 | 2025-05-03 01:45:00 |
| - | 1561002_MatoSpectoru_muffet-fvgc-f_e_psnocumlr.png | 807435 | 2025-05-03 01:45:00 |
| - | 1561003_MatoSpectoru_muffet-fvgc-f_e_pscumlr.json | 9405 | 2025-05-03 01:45:00 |
| - | 1561003_MatoSpectoru_muffet-fvgc-f_e_pscumlr.png | 835725 | 2025-05-03 01:45:00 |
| - | 1563816_MatoSpectoru_vanilla-fvgc-_e_-psnocumlr.json | 9609 | 2025-05-03 02:32:04 |
| - | 1563816_MatoSpectoru_vanilla-fvgc-_e_-psnocumlr.png | 674382 | 2025-05-03 02:32:04 |
| - | 1563818_MatoSpectoru_vanilla-fvgc-_e_-pscumlr.json | 9609 | 2025-05-03 02:32:05 |
| - | 1563818_MatoSpectoru_vanilla-fvgc-_e_-pscumlr.png | 679853 | 2025-05-03 02:32:05 |
| - | 1609173_MatoSpectoru_wavetheswallowfcs4fullcolorf2pslrf.json | 9822 | 2025-05-03 14:05:05 |
| - | 1609173_MatoSpectoru_wavetheswallowfcs4fullcolorf2pslrf.png | 731607 | 2025-05-03 14:05:05 |
| - | 1609174_MatoSpectoru_wavetheswallowfcs4fullcolorf2ps_cum_blrf.json | 9822 | 2025-05-03 14:05:05 |
| - | 1609174_MatoSpectoru_wavetheswallowfcs4fullcolorf2ps_cum_blrf.png | 747019 | 2025-05-03 14:05:05 |
| - | 1615100_MatoSpectoru_blazikenfullcolorcommwetfpslrb.json | 6257 | 2025-05-03 16:19:51 |
| - | 1615100_MatoSpectoru_blazikenfullcolorcommwetfpslrb.png | 818028 | 2025-05-03 16:19:51 |
| - | 1615448_MatoSpectoru_shadefullcolorpslr02b.json | 8664 | 2025-05-03 16:24:46 |
| - | 1615448_MatoSpectoru_shadefullcolorpslr02b.png | 802728 | 2025-05-03 16:24:46 |
| - | 1615451_MatoSpectoru_shadefullcolorpslr01.json | 8664 | 2025-05-03 16:24:46 |
| - | 1615451_MatoSpectoru_shadefullcolorpslr01.png | 681155 | 2025-05-03 16:24:46 |
| - | 1627046_MatoSpectoru_ranamonfcs4f2_e_ps2.json | 8535 | 2025-05-03 19:32:06 |
| - | 1627046_MatoSpectoru_ranamonfcs4f2_e_ps2.png | 588501 | 2025-05-03 19:32:06 |
| - | 1627048_MatoSpectoru_ranamonfcs4f2_e_ps2cum.json | 8535 | 2025-05-03 19:32:06 |
| - | 1627048_MatoSpectoru_ranamonfcs4f2_e_ps2cum.png | 600815 | 2025-05-03 19:32:06 |
| - | 1692269_MatoSpectoru_rouge_the_bat_-_sketch_comm_fpslrcum2.0b.json | 6474 | 2025-05-04 11:42:11 |
| - | 1692269_MatoSpectoru_rouge_the_bat_-_sketch_comm_fpslrcum2.0b.png | 424356 | 2025-05-04 11:42:11 |
| - | 1697505_MatoSpectoru_candy_kong_x_rouge_the_bat_-_full_color_comm_fpsblrb.json | 6819 | 2025-05-04 13:16:23 |
| - | 1697505_MatoSpectoru_candy_kong_x_rouge_the_bat_-_full_color_comm_fpsblrb.png | 1399769 | 2025-05-04 13:16:23 |
| - | 1699733_MatoSpectoru_raritycommanonlineartslimpslrb.json | 6312 | 2025-05-04 13:55:52 |
| - | 1699733_MatoSpectoru_raritycommanonlineartslimpslrb.png | 485582 | 2025-05-04 13:55:52 |
| - | 1706761_MatoSpectoru_coco_bandicoot_-_comm_full_color_f_01pslr.json | 12173 | 2025-05-04 15:54:42 |
| - | 1706761_MatoSpectoru_coco_bandicoot_-_comm_full_color_f_01pslr.png | 436635 | 2025-05-04 15:54:42 |
| - | 1706763_MatoSpectoru_coco_bandicoot_-_comm_full_color_f_02pslr.json | 12173 | 2025-05-04 15:54:43 |
| - | 1706763_MatoSpectoru_coco_bandicoot_-_comm_full_color_f_02pslr.png | 499842 | 2025-05-04 15:54:43 |
| - | 1706765_MatoSpectoru_coco_bandicoot_-_comm_full_color_f_02pslrcum01.json | 12173 | 2025-05-04 15:54:43 |
| - | 1706765_MatoSpectoru_coco_bandicoot_-_comm_full_color_f_02pslrcum01.png | 516883 | 2025-05-04 15:54:43 |
| - | 1714547_MatoSpectoru_renamon_-_full_color_f2ps_fix_lrb.json | 7676 | 2025-05-04 17:46:54 |
| - | 1714547_MatoSpectoru_renamon_-_full_color_f2ps_fix_lrb.png | 669006 | 2025-05-04 17:46:54 |
| - | 1715838_MatoSpectoru_hexmaniacfc_0008pslrb2crop.json | 7156 | 2025-05-04 18:11:23 |
| - | 1715838_MatoSpectoru_hexmaniacfc_0008pslrb2crop.png | 303458 | 2025-05-04 18:11:23 |
| - | 1716715_MatoSpectoru_taokakacommfullcolor_e_f2lrbonus.json | 7043 | 2025-05-04 18:25:28 |
| - | 1716715_MatoSpectoru_taokakacommfullcolor_e_f2lrbonus.png | 621431 | 2025-05-04 18:25:28 |
| - | 1721845_MatoSpectoru_demona_-_full_color_commfretouchps_e_cspflrb2.json | 7032 | 2025-05-04 19:01:31 |
| - | 1721845_MatoSpectoru_demona_-_full_color_commfretouchps_e_cspflrb2.png | 815990 | 2025-05-04 19:01:31 |
| - | 1721862_MatoSpectoru_felicia---full-color-commission-f_e_pslrb2cropink.json | 7435 | 2025-05-04 19:45:21 |
| - | 1721862_MatoSpectoru_felicia---full-color-commission-f_e_pslrb2cropink.png | 887755 | 2025-05-04 19:45:21 |
| - | 1731072_MatoSpectoru_renamonlr.json | 10256 | 2025-05-04 22:02:01 |
| - | 1731072_MatoSpectoru_renamonlr.png | 599795 | 2025-05-04 22:02:01 |
| - | 1731075_MatoSpectoru_renamonlrcum.json | 10256 | 2025-05-04 22:02:02 |
| - | 1731075_MatoSpectoru_renamonlrcum.png | 609844 | 2025-05-04 22:02:02 |
| - | 1737318_MatoSpectoru_tsareena_comm_f_e_pslr.json | 7127 | 2025-05-04 23:36:47 |
| - | 1737318_MatoSpectoru_tsareena_comm_f_e_pslr.png | 401042 | 2025-05-04 23:36:47 |
| - | 1748198_MatoSpectoru_tiny_kong_-_comm_fullcolor_fps_xlr.json | 7136 | 2025-05-05 02:16:15 |
| - | 1748198_MatoSpectoru_tiny_kong_-_comm_fullcolor_fps_xlr.png | 368921 | 2025-05-05 02:16:15 |
| - | 1748767_MatoSpectoru_lammy_retouch_f_e_pslr_retouch_e_lrxl.json | 7441 | 2025-05-05 02:24:41 |
| - | 1748767_MatoSpectoru_lammy_retouch_f_e_pslr_retouch_e_lrxl.png | 280897 | 2025-05-05 02:24:41 |
| - | 1751906_MatoSpectoru_poppy_-_league_of_legends_f_e_psxhqlretouchc.json | 7296 | 2025-05-05 03:14:54 |
| - | 1751906_MatoSpectoru_poppy_-_league_of_legends_f_e_psxhqlretouchc.png | 473589 | 2025-05-05 03:14:54 |
| - | 1751962_MatoSpectoru_commround11inkfaremake.json | 12506 | 2025-05-05 03:15:45 |
| - | 1751962_MatoSpectoru_commround11inkfaremake.png | 3407390 | 2025-05-05 03:15:45 |
| - | 1754836_MatoSpectoru_pheromosa_-_comm_f2_psblrnocum.json | 10569 | 2025-05-05 04:01:21 |
| - | 1754836_MatoSpectoru_pheromosa_-_comm_f2_psblrnocum.png | 368473 | 2025-05-05 04:01:21 |
| - | 1754838_MatoSpectoru_pheromosa_-_comm_f2_psblrcum.json | 10569 | 2025-05-05 04:01:21 |
| - | 1754838_MatoSpectoru_pheromosa_-_comm_f2_psblrcum.png | 374084 | 2025-05-05 04:01:21 |
| - | 1754839_MatoSpectoru_sunlight_carbuncle_-_full_color_comm_f_e_psblrb.json | 7855 | 2025-05-05 04:01:24 |
| - | 1754839_MatoSpectoru_sunlight_carbuncle_-_full_color_comm_f_e_psblrb.png | 471917 | 2025-05-05 04:01:24 |
| - | 1785983_MatoSpectoru_amy_rose_fcs_1_pslrb.json | 7293 | 2025-05-05 11:58:54 |
| - | 1785983_MatoSpectoru_amy_rose_fcs_1_pslrb.png | 999357 | 2025-05-05 11:58:54 |
| - | 1787330_MatoSpectoru_midna_fcs_1_fcf_2_pslr3.json | 7608 | 2025-05-05 12:17:06 |
| - | 1787330_MatoSpectoru_midna_fcs_1_fcf_2_pslr3.png | 614056 | 2025-05-05 12:17:06 |
| - | 1790198_MatoSpectoru_fluttershy_pinkie_pie_comm_psb_lr2c2.json | 6902 | 2025-05-05 12:54:07 |
| - | 1790198_MatoSpectoru_fluttershy_pinkie_pie_comm_psb_lr2c2.png | 811749 | 2025-05-05 12:54:07 |
| - | 1790989_MatoSpectoru_meloetta_fcs_1_fc_f2_ps_bsai_lr.json | 7179 | 2025-05-05 13:08:28 |
| - | 1790989_MatoSpectoru_meloetta_fcs_1_fc_f2_ps_bsai_lr.png | 461863 | 2025-05-05 13:08:28 |
| - | 1794586_MatoSpectoru_pinkie_pie_fc_f_ps_lrb_2.0.json | 11271 | 2025-05-05 14:06:53 |
| - | 1794586_MatoSpectoru_pinkie_pie_fc_f_ps_lrb_2.0.png | 785588 | 2025-05-05 14:06:53 |
| - | 1794587_MatoSpectoru_pinkie_pie_fc_f_ps_lrb_logo_2.0.json | 11271 | 2025-05-05 14:06:53 |
| - | 1794587_MatoSpectoru_pinkie_pie_fc_f_ps_lrb_logo_2.0.png | 695230 | 2025-05-05 14:06:53 |
| - | 1794601_MatoSpectoru_pinkie_pie_anthro_fc_f_normal_b_ps_lr.json | 12826 | 2025-05-05 14:07:06 |
| - | 1794601_MatoSpectoru_pinkie_pie_anthro_fc_f_normal_b_ps_lr.png | 374334 | 2025-05-05 14:07:06 |
| - | 1794602_MatoSpectoru_pinkie_pie_anthro_fc_f_normal_cow_b_ps_lr.json | 12826 | 2025-05-05 14:07:07 |
| - | 1794602_MatoSpectoru_pinkie_pie_anthro_fc_f_normal_cow_b_ps_lr.png | 459862 | 2025-05-05 14:07:07 |
| - | 1807231_MatoSpectoru_commround2-2017-_febr_-_inkfa.json | 12530 | 2025-05-05 17:33:03 |
| - | 1807231_MatoSpectoru_commround2-2017-_febr_-_inkfa.png | 3565942 | 2025-05-05 17:33:03 |
| - | 1812513_MatoSpectoru_candykongfccommpshqblr.json | 7275 | 2025-05-05 18:58:18 |
| - | 1812513_MatoSpectoru_candykongfccommpshqblr.png | 455801 | 2025-05-05 18:58:18 |
| - | 1813438_MatoSpectoru_lilacfpfullcolorcommpsb_cumsai_inkblr.json | 11268 | 2025-05-05 19:14:19 |
| - | 1813438_MatoSpectoru_lilacfpfullcolorcommpsb_cumsai_inkblr.png | 426266 | 2025-05-05 19:14:19 |
| - | 1813442_MatoSpectoru_lilacfpfullcolorcommpsb_cumsai_inkbcumlr.json | 11268 | 2025-05-05 19:14:20 |
| - | 1813442_MatoSpectoru_lilacfpfullcolorcommpsb_cumsai_inkbcumlr.png | 436313 | 2025-05-05 19:14:20 |
| - | 1830000_MatoSpectoru_sunlight_carbuncle_2_-_full_color_comm_f_ps_nocum_-_e_lrb.json | 11558 | 2025-05-05 23:36:34 |
| - | 1830000_MatoSpectoru_sunlight_carbuncle_2_-_full_color_comm_f_ps_nocum_-_e_lrb.png | 370913 | 2025-05-05 23:36:34 |
| - | 1830001_MatoSpectoru_sunlight_carbuncle_2_-_full_color_comm_f_ps_cum_-_e_lrb.json | 11558 | 2025-05-05 23:36:34 |
| - | 1830001_MatoSpectoru_sunlight_carbuncle_2_-_full_color_comm_f_ps_cum_-_e_lrb.png | 342417 | 2025-05-05 23:36:34 |
| - | 1834004_MatoSpectoru_commissions_round_3_-_2017_-_full_color_flat_color_sketch_inkbunny.json | 20471 | 2025-05-06 00:40:20 |
| - | 1834004_MatoSpectoru_commissions_round_3_-_2017_-_full_color_flat_color_sketch_inkbunny.png | 3336925 | 2025-05-06 00:40:20 |
| - | 1834007_MatoSpectoru_commissions_round_3_-_2017_-_full_color_inkbunny.json | 20471 | 2025-05-06 00:40:20 |
| - | 1834007_MatoSpectoru_commissions_round_3_-_2017_-_full_color_inkbunny.png | 2085919 | 2025-05-06 00:40:20 |
| - | 1834012_MatoSpectoru_commissions_round_3_-_2017_-_lineart_flat_color.json | 20471 | 2025-05-06 00:40:20 |
| - | 1834012_MatoSpectoru_commissions_round_3_-_2017_-_lineart_flat_color.png | 695489 | 2025-05-06 00:40:20 |
| - | 1834013_MatoSpectoru_commissions_round_3_-_2017_-_sketch.json | 20471 | 2025-05-06 00:40:20 |
| - | 1834013_MatoSpectoru_commissions_round_3_-_2017_-_sketch.png | 552893 | 2025-05-06 00:40:20 |
| - | 1836858_MatoSpectoru_gilda_-_mlp_-_fullcolor_comm_ps_lr.json | 7470 | 2025-05-06 01:24:24 |
| - | 1836858_MatoSpectoru_gilda_-_mlp_-_fullcolor_comm_ps_lr.png | 501994 | 2025-05-06 01:24:24 |
| - | 1861663_MatoSpectoru_jet_x_taokaka_-_sketch_comm_2.0_fpslr.json | 7312 | 2025-05-06 07:41:59 |
| - | 1861663_MatoSpectoru_jet_x_taokaka_-_sketch_comm_2.0_fpslr.png | 270529 | 2025-05-06 07:41:59 |
| - | 1875745_MatoSpectoru_amina_moroboshi_-_fc_lr_ps.json | 10435 | 2025-05-06 11:23:20 |
| - | 1875745_MatoSpectoru_amina_moroboshi_-_fc_lr_ps.png | 1750578 | 2025-05-06 11:23:20 |
| - | 1875746_MatoSpectoru_amina_moroboshi_-_fc_lr_ps_cum.json | 10435 | 2025-05-06 11:23:20 |
| - | 1875746_MatoSpectoru_amina_moroboshi_-_fc_lr_ps_cum.png | 1523299 | 2025-05-06 11:23:20 |
| - | 1918698_MatoSpectoru_commissions_round_-_25_may_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_-_full_color.json | 25312 | 2025-05-06 22:29:32 |
| - | 1918698_MatoSpectoru_commissions_round_-_25_may_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_-_full_color.png | 1950035 | 2025-05-06 22:29:32 |
| - | 1918700_MatoSpectoru_commissions_round_-_25_may_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_-_sketch.json | 25312 | 2025-05-06 22:29:33 |
| - | 1918700_MatoSpectoru_commissions_round_-_25_may_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_-_sketch.png | 552893 | 2025-05-06 22:29:33 |
| - | 1918701_MatoSpectoru_commissions_round_-_25_may_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_-_mlp.json | 25312 | 2025-05-06 22:29:33 |
| - | 1918701_MatoSpectoru_commissions_round_-_25_may_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_-_mlp.png | 1287545 | 2025-05-06 22:29:33 |
| - | 1918869_MatoSpectoru_commissions_round_-_25_may_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_b.json | 25312 | 2025-05-06 22:29:32 |
| - | 1918869_MatoSpectoru_commissions_round_-_25_may_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_b.png | 4418526 | 2025-05-06 22:29:32 |
| - | 1918873_MatoSpectoru_commissions_round_-_25_may_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_-_flat_color_b.json | 25312 | 2025-05-06 22:29:32 |
| - | 1918873_MatoSpectoru_commissions_round_-_25_may_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_-_flat_color_b.png | 621989 | 2025-05-06 22:29:32 |
| - | 1921793_MatoSpectoru_4_girls_-_sketchs_comm_-sketch_f_psb_lr.json | 8442 | 2025-05-06 23:18:04 |
| - | 1921793_MatoSpectoru_4_girls_-_sketchs_comm_-sketch_f_psb_lr.png | 190664 | 2025-05-06 23:18:04 |
| - | 1922877_MatoSpectoru_tiff_-_gobling_-_full_color_comm_f_ps_lrb.json | 7080 | 2025-05-06 23:35:10 |
| - | 1922877_MatoSpectoru_tiff_-_gobling_-_full_color_comm_f_ps_lrb.png | 491143 | 2025-05-06 23:35:10 |
| - | 1924110_MatoSpectoru_amy_rose_x_fox_mccloud_-_full_color_comm_ps_b_e_csp_01_lrc.json | 8541 | 2025-05-06 23:54:15 |
| - | 1924110_MatoSpectoru_amy_rose_x_fox_mccloud_-_full_color_comm_ps_b_e_csp_01_lrc.png | 1395804 | 2025-05-06 23:54:15 |
| - | 1928265_MatoSpectoru_candy_kong_x_horse_-_fullcolor_comm_f_pslr_nocum_.json | 13417 | 2025-05-07 00:59:03 |
| - | 1928265_MatoSpectoru_candy_kong_x_horse_-_fullcolor_comm_f_pslr_nocum_.png | 635055 | 2025-05-07 00:59:03 |
| - | 1928266_MatoSpectoru_candy_kong_x_horse_-_fullcolor_comm_f_pslr_onlycum_.json | 13417 | 2025-05-07 00:59:04 |
| - | 1928266_MatoSpectoru_candy_kong_x_horse_-_fullcolor_comm_f_pslr_onlycum_.png | 664480 | 2025-05-07 00:59:04 |
| - | 1928267_MatoSpectoru_candy_kong_x_horse_-_fullcolor_comm_f_pslr_cummilk_.json | 13417 | 2025-05-07 00:59:04 |
| - | 1928267_MatoSpectoru_candy_kong_x_horse_-_fullcolor_comm_f_pslr_cummilk_.png | 674608 | 2025-05-07 00:59:04 |
| - | 1934455_MatoSpectoru_max_x_peg_-_comm_sketch_f2_pslrb_whiteglovesmax.json | 11052 | 2025-05-07 02:41:45 |
| - | 1934455_MatoSpectoru_max_x_peg_-_comm_sketch_f2_pslrb_whiteglovesmax.png | 149051 | 2025-05-07 02:41:45 |
| - | 1934458_MatoSpectoru_max_x_peg_-_comm_sketch_f2_pslrb_whitegloves.json | 11052 | 2025-05-07 02:41:45 |
| - | 1934458_MatoSpectoru_max_x_peg_-_comm_sketch_f2_pslrb_whitegloves.png | 126831 | 2025-05-07 02:41:45 |
| - | 1941391_MatoSpectoru_rouge_the_bat_-_comm_full_color_f_psxlr.json | 11110 | 2025-05-07 04:38:08 |
| - | 1941391_MatoSpectoru_rouge_the_bat_-_comm_full_color_f_psxlr.png | 438200 | 2025-05-07 04:38:08 |
| - | 1941394_MatoSpectoru_rouge_the_bat_-_comm_full_color_f_psxlr_nonote.json | 11110 | 2025-05-07 04:38:08 |
| - | 1941394_MatoSpectoru_rouge_the_bat_-_comm_full_color_f_psxlr_nonote.png | 416041 | 2025-05-07 04:38:08 |
| - | 1941403_MatoSpectoru_rouge_the_bat_x_tails_01_pslrb2.json | 14772 | 2025-05-07 04:38:18 |
| - | 1941403_MatoSpectoru_rouge_the_bat_x_tails_01_pslrb2.png | 706388 | 2025-05-07 04:38:18 |
| - | 1941406_MatoSpectoru_rouge_the_bat_x_tails_02_-_comm_full_color_fpslr.json | 14772 | 2025-05-07 04:38:18 |
| - | 1941406_MatoSpectoru_rouge_the_bat_x_tails_02_-_comm_full_color_fpslr.png | 639803 | 2025-05-07 04:38:18 |
| - | 1942269_MatoSpectoru_rouge_the_bat_x_tails_02_-_comm_full_color_fpslr2_cume_.json | 14772 | 2025-05-07 04:38:19 |
| - | 1942269_MatoSpectoru_rouge_the_bat_x_tails_02_-_comm_full_color_fpslr2_cume_.png | 653969 | 2025-05-07 04:38:19 |
| - | 1942564_MatoSpectoru_renamon_x_impmon_2_-_comm_sketch_01-02_b_-_01pslr.json | 13899 | 2025-05-07 04:57:02 |
| - | 1942564_MatoSpectoru_renamon_x_impmon_2_-_comm_sketch_01-02_b_-_01pslr.png | 180441 | 2025-05-07 04:57:02 |
| - | 1942565_MatoSpectoru_renamon_x_impmon_2_-_comm_sketch_01-02_b_-_02pslr.json | 13899 | 2025-05-07 04:57:02 |
| - | 1942565_MatoSpectoru_renamon_x_impmon_2_-_comm_sketch_01-02_b_-_02pslr.png | 180153 | 2025-05-07 04:57:02 |
| - | 1942566_MatoSpectoru_renamon_x_impmon_2_-_comm_sketch_01-02_b_-_02cumpslr.json | 13899 | 2025-05-07 04:57:02 |
| - | 1942566_MatoSpectoru_renamon_x_impmon_2_-_comm_sketch_01-02_b_-_02cumpslr.png | 150761 | 2025-05-07 04:57:02 |
| - | 1961889_MatoSpectoru_sonic_x_krystal_-_comm_sketch_fpslr.json | 7603 | 2025-05-07 09:42:29 |
| - | 1961889_MatoSpectoru_sonic_x_krystal_-_comm_sketch_fpslr.png | 221838 | 2025-05-07 09:42:29 |
| - | 1961901_MatoSpectoru_noah_-_full_color_-_comm_fps_blr_ib.json | 6728 | 2025-05-07 09:42:49 |
| - | 1961901_MatoSpectoru_noah_-_full_color_-_comm_fps_blr_ib.png | 615669 | 2025-05-07 09:42:49 |
| - | 1961947_MatoSpectoru_captain_amelia_-_comm_fclr_fpslrb.json | 7660 | 2025-05-07 09:43:48 |
| - | 1961947_MatoSpectoru_captain_amelia_-_comm_fclr_fpslrb.png | 907269 | 2025-05-07 09:43:48 |
| - | 1963037_MatoSpectoru_applejack_-_mlp_-_comm_fpsclr.json | 8254 | 2025-05-07 10:00:50 |
| - | 1963037_MatoSpectoru_applejack_-_mlp_-_comm_fpsclr.png | 576975 | 2025-05-07 10:00:50 |
| - | 1968859_MatoSpectoru_alphys_-_sketch_comm_nocum_fpslrb.json | 10579 | 2025-05-07 11:35:13 |
| - | 1968859_MatoSpectoru_alphys_-_sketch_comm_nocum_fpslrb.png | 180989 | 2025-05-07 11:35:13 |
| - | 1968860_MatoSpectoru_alphys_-_sketch_comm_cum_fpslrb.json | 10579 | 2025-05-07 11:35:13 |
| - | 1968860_MatoSpectoru_alphys_-_sketch_comm_cum_fpslrb.png | 190319 | 2025-05-07 11:35:13 |
| - | 1968874_MatoSpectoru_wave_the_swallow_-_futa_x_rouge_the_bat_-_sketch_comm_01pslr.json | 13687 | 2025-05-07 11:35:23 |
| - | 1968874_MatoSpectoru_wave_the_swallow_-_futa_x_rouge_the_bat_-_sketch_comm_01pslr.png | 151927 | 2025-05-07 11:35:23 |
| - | 1968875_MatoSpectoru_wave_the_swallow_-_futa_x_rouge_the_bat_-_sketch_comm_02pslr.json | 13687 | 2025-05-07 11:35:23 |
| - | 1968875_MatoSpectoru_wave_the_swallow_-_futa_x_rouge_the_bat_-_sketch_comm_02pslr.png | 154320 | 2025-05-07 11:35:23 |
| - | 1968876_MatoSpectoru_wave_the_swallow_-_futa_x_rouge_the_bat_-_sketch_comm_02bpslr.json | 13687 | 2025-05-07 11:35:23 |
| - | 1968876_MatoSpectoru_wave_the_swallow_-_futa_x_rouge_the_bat_-_sketch_comm_02bpslr.png | 158853 | 2025-05-07 11:35:23 |
| - | 1968889_MatoSpectoru_cream_x_futa-vanilla_-_sketch_comm_nocum_fpslr.json | 13715 | 2025-05-07 11:35:35 |
| - | 1968889_MatoSpectoru_cream_x_futa-vanilla_-_sketch_comm_nocum_fpslr.png | 206411 | 2025-05-07 11:35:35 |
| - | 1968890_MatoSpectoru_cream_x_futa-vanilla_-_sketch_comm_cum_fpslr.json | 13715 | 2025-05-07 11:35:35 |
| - | 1968890_MatoSpectoru_cream_x_futa-vanilla_-_sketch_comm_cum_fpslr.png | 213597 | 2025-05-07 11:35:35 |
| - | 1968891_MatoSpectoru_cream_x_futa-vanilla_-_sketch_comm_cum_02_fpslr.json | 13715 | 2025-05-07 11:35:35 |
| - | 1968891_MatoSpectoru_cream_x_futa-vanilla_-_sketch_comm_cum_02_fpslr.png | 228184 | 2025-05-07 11:35:35 |
| - | 1976964_MatoSpectoru_chatalie_-_full_color_comm_f2pslr.json | 11622 | 2025-05-07 13:40:42 |
| - | 1976964_MatoSpectoru_chatalie_-_full_color_comm_f2pslr.png | 451219 | 2025-05-07 13:40:42 |
| - | 1976965_MatoSpectoru_chatalie_-_full_color_comm_cum_f2pslr.json | 11622 | 2025-05-07 13:40:43 |
| - | 1976965_MatoSpectoru_chatalie_-_full_color_comm_cum_f2pslr.png | 455381 | 2025-05-07 13:40:43 |
| - | 1981780_MatoSpectoru_skyler_-_shotaku_-_commb_pslr.json | 15844 | 2025-05-07 14:58:18 |
| - | 1981780_MatoSpectoru_skyler_-_shotaku_-_commb_pslr.png | 2495432 | 2025-05-07 14:58:18 |
| - | 1982572_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_001.json | 33345 | 2025-05-07 15:11:14 |
| - | 1982572_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_001.png | 660518 | 2025-05-07 15:11:14 |
| - | 1982574_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_002.json | 33345 | 2025-05-07 15:11:14 |
| - | 1982574_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_002.png | 683661 | 2025-05-07 15:11:14 |
| - | 1982576_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_002_b.json | 33345 | 2025-05-07 15:11:14 |
| - | 1982576_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_002_b.png | 688206 | 2025-05-07 15:11:14 |
| - | 1982577_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_003.json | 33345 | 2025-05-07 15:11:14 |
| - | 1982577_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_003.png | 679513 | 2025-05-07 15:11:14 |
| - | 1982579_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_003_c.json | 33345 | 2025-05-07 15:11:14 |
| - | 1982579_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_003_c.png | 683884 | 2025-05-07 15:11:14 |
| - | 1982581_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_004.json | 33345 | 2025-05-07 15:11:15 |
| - | 1982581_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_004.png | 697540 | 2025-05-07 15:11:15 |
| - | 1982582_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_004_b.json | 33345 | 2025-05-07 15:11:15 |
| - | 1982582_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_004_b.png | 695314 | 2025-05-07 15:11:15 |
| - | 1982584_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_004_c.json | 33345 | 2025-05-07 15:11:15 |
| - | 1982584_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_004_c.png | 704605 | 2025-05-07 15:11:15 |
| - | 1982585_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_005_c.json | 33345 | 2025-05-07 15:11:16 |
| - | 1982585_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_005_c.png | 699084 | 2025-05-07 15:11:16 |
| - | 1982586_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_005.json | 33345 | 2025-05-07 15:11:16 |
| - | 1982586_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_005.png | 674757 | 2025-05-07 15:11:16 |
| - | 1983331_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_005.json | 33345 | 2025-05-07 15:11:16 |
| - | 1983331_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_005.png | 674757 | 2025-05-07 15:11:16 |
| - | 1983333_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_005_b.json | 33345 | 2025-05-07 15:11:16 |
| - | 1983333_MatoSpectoru_queen_chrysalis_-_mlp_-_comm_pslr_005_b.png | 685359 | 2025-05-07 15:11:16 |
| - | 1983762_MatoSpectoru_commissions_round_-_29_julio_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_c.json | 14324 | 2025-05-07 15:29:07 |
| - | 1983762_MatoSpectoru_commissions_round_-_29_julio_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_c.png | 5335064 | 2025-05-07 15:29:07 |
| - | 2009564_MatoSpectoru_mina_mongoose_-_full_color_comm_fps_lr.json | 14247 | 2025-05-07 22:34:45 |
| - | 2009564_MatoSpectoru_mina_mongoose_-_full_color_comm_fps_lr.png | 1864992 | 2025-05-07 22:34:45 |
| - | 2009567_MatoSpectoru_mina_mongoose_-_full_color_comm_fps_lr_cumv.json | 14247 | 2025-05-07 22:34:46 |
| - | 2009567_MatoSpectoru_mina_mongoose_-_full_color_comm_fps_lr_cumv.png | 1862264 | 2025-05-07 22:34:46 |
| - | 2009570_MatoSpectoru_mina_mongoose_-_full_color_comm_fps_lr_cumanus.json | 14247 | 2025-05-07 22:34:46 |
| - | 2009570_MatoSpectoru_mina_mongoose_-_full_color_comm_fps_lr_cumanus.png | 1866823 | 2025-05-07 22:34:46 |
| - | 2010596_MatoSpectoru_commissions_round_-_25_agost_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_c_lr.json | 14367 | 2025-05-07 22:49:54 |
| - | 2010596_MatoSpectoru_commissions_round_-_25_agost_-_2017_-_full_color_flat_color_sketch_inkbunny_bonus_c_lr.png | 2077705 | 2025-05-07 22:49:54 |
| - | 2011549_MatoSpectoru_braixen_-_shotaku_-_comm_flat_color_f_pslr.json | 20417 | 2025-05-07 23:05:12 |
| - | 2011549_MatoSpectoru_braixen_-_shotaku_-_comm_flat_color_f_pslr.png | 679284 | 2025-05-07 23:05:12 |
| - | 2016600_MatoSpectoru_jeanie_-_jirachi_oc_-_flat_color_comm_f_psxlr2_nomilk_.json | 11883 | 2025-05-08 00:21:32 |
| - | 2016600_MatoSpectoru_jeanie_-_jirachi_oc_-_flat_color_comm_f_psxlr2_nomilk_.png | 308431 | 2025-05-08 00:21:32 |
| - | 2016604_MatoSpectoru_jeanie_-_jirachi_oc_-_flat_color_comm_f_psxlr2_milk_.json | 11883 | 2025-05-08 00:21:32 |
| - | 2016604_MatoSpectoru_jeanie_-_jirachi_oc_-_flat_color_comm_f_psxlr2_milk_.png | 323907 | 2025-05-08 00:21:32 |
| - | 2019740_MatoSpectoru_macha_x_red_-_sketch_comm_f_pslr.json | 7435 | 2025-05-08 01:10:22 |
| - | 2019740_MatoSpectoru_macha_x_red_-_sketch_comm_f_pslr.png | 229513 | 2025-05-08 01:10:22 |
| - | 2020988_MatoSpectoru_gwynn_-_full_color_comm_fps_lr.json | 8663 | 2025-05-08 01:27:08 |
| - | 2020988_MatoSpectoru_gwynn_-_full_color_comm_fps_lr.png | 1625108 | 2025-05-08 01:27:08 |
| - | 2020998_MatoSpectoru_millie_-_oc_-_full_color_comm_f02_pslr.json | 9751 | 2025-05-08 01:27:21 |
| - | 2020998_MatoSpectoru_millie_-_oc_-_full_color_comm_f02_pslr.png | 1850484 | 2025-05-08 01:27:21 |
| - | 2021005_MatoSpectoru_millie_-_oc_-_full_color_comm_f01_pslr.json | 9751 | 2025-05-08 01:27:21 |
| - | 2021005_MatoSpectoru_millie_-_oc_-_full_color_comm_f01_pslr.png | 1881538 | 2025-05-08 01:27:21 |
| - | 2022924_MatoSpectoru_azumarill_-_sketch_comm_gift_fc_pslr_nocum_2.0.json | 12920 | 2025-05-08 01:55:51 |
| - | 2022924_MatoSpectoru_azumarill_-_sketch_comm_gift_fc_pslr_nocum_2.0.png | 1243521 | 2025-05-08 01:55:51 |
| - | 2022926_MatoSpectoru_azumarill_-_sketch_comm_gift_fc_pslr_cum_2.0.json | 12920 | 2025-05-08 01:55:51 |
| - | 2022926_MatoSpectoru_azumarill_-_sketch_comm_gift_fc_pslr_cum_2.0.png | 1266585 | 2025-05-08 01:55:51 |
| - | 2027204_MatoSpectoru_guilt_-_full_color_comm_fps_f2xlr.json | 7993 | 2025-05-08 03:01:30 |
| - | 2027204_MatoSpectoru_guilt_-_full_color_comm_fps_f2xlr.png | 1521224 | 2025-05-08 03:01:30 |
| - | 2029483_MatoSpectoru_nila_stern_-_oc_nsfw_pslrb2.json | 9715 | 2025-05-08 03:34:31 |
| - | 2029483_MatoSpectoru_nila_stern_-_oc_nsfw_pslrb2.png | 1799066 | 2025-05-08 03:34:31 |
| - | 2030746_MatoSpectoru_nila_stern_-_oc_nsfw_fc_psf_lr_crop_01b_withnametittlejapan_.json | 10309 | 2025-05-08 03:46:18 |
| - | 2030746_MatoSpectoru_nila_stern_-_oc_nsfw_fc_psf_lr_crop_01b_withnametittlejapan_.png | 3161391 | 2025-05-08 03:46:18 |
| - | 2033216_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr.json | 21411 | 2025-05-08 04:32:46 |
| - | 2033216_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr.png | 1811904 | 2025-05-08 04:32:46 |
| - | 2033222_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr_crop01.json | 21411 | 2025-05-08 04:32:46 |
| - | 2033222_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr_crop01.png | 678713 | 2025-05-08 04:32:46 |
| - | 2033224_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr_crop01naked.json | 21411 | 2025-05-08 04:32:47 |
| - | 2033224_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr_crop01naked.png | 272345 | 2025-05-08 04:32:47 |
| - | 2033225_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr_futacrop.json | 21411 | 2025-05-08 04:32:47 |
| - | 2033225_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr_futacrop.png | 477978 | 2025-05-08 04:32:47 |
| - | 2033227_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr_crop02.json | 21411 | 2025-05-08 04:32:47 |
| - | 2033227_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr_crop02.png | 327248 | 2025-05-08 04:32:47 |
| - | 2033228_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr_crop03.json | 21411 | 2025-05-08 04:32:47 |
| - | 2033228_MatoSpectoru_alice_sheepstar_-_oc_nsfw_character_sheet_fpslr_crop03.png | 141326 | 2025-05-08 04:32:47 |
| - | 2036506_MatoSpectoru_vanillaslut-maniafc01pslrb.json | 10538 | 2025-05-08 05:19:49 |
| - | 2036506_MatoSpectoru_vanillaslut-maniafc01pslrb.png | 1925896 | 2025-05-08 05:19:49 |
| - | 2036507_MatoSpectoru_vanillaslut-maniafc02pslrb.json | 10538 | 2025-05-08 05:19:49 |
| - | 2036507_MatoSpectoru_vanillaslut-maniafc02pslrb.png | 1920755 | 2025-05-08 05:19:49 |
| - | 2038269_MatoSpectoru_broodal_-_mario_fc_fbpslr.json | 7860 | 2025-05-08 05:47:04 |
| - | 2038269_MatoSpectoru_broodal_-_mario_fc_fbpslr.png | 864136 | 2025-05-08 05:47:04 |
| - | 2045208_MatoSpectoru_lupe_the_wolf_x_mina_mongoose_-_fullcolorcomm_fpsxlrbspit.json | 8873 | 2025-05-08 07:34:43 |
| - | 2045208_MatoSpectoru_lupe_the_wolf_x_mina_mongoose_-_fullcolorcomm_fpsxlrbspit.png | 808413 | 2025-05-08 07:34:43 |
| - | 2047210_MatoSpectoru_mozugiganticnsfwfpslrb2.json | 6771 | 2025-05-08 08:04:30 |
| - | 2047210_MatoSpectoru_mozugiganticnsfwfpslrb2.png | 728231 | 2025-05-08 08:04:30 |
| - | 2061167_MatoSpectoru_sheepmomarttrade_sssonic2fcfbpsflrc.json | 7865 | 2025-07-27 05:53:22 |
| - | 2061167_MatoSpectoru_sheepmomarttrade_sssonic2fcfbpsflrc.png | 960872 | 2025-07-27 05:53:22 |
| - | 2068736_MatoSpectoru_sticksthebadger_comm_fullcolor01fpslr.json | 21577 | 2025-06-24 08:57:07 |
| - | 2068736_MatoSpectoru_sticksthebadger_comm_fullcolor01fpslr.png | 764063 | 2025-06-24 08:57:07 |
| - | 2068739_MatoSpectoru_sticksthebadger_comm_fullcolor02fpslr.json | 21577 | 2025-06-24 08:57:08 |
| - | 2068739_MatoSpectoru_sticksthebadger_comm_fullcolor02fpslr.png | 786421 | 2025-06-24 08:57:08 |
| - | 2068742_MatoSpectoru_sticksthebadger_comm_fullcolor03fpslr.json | 21577 | 2025-06-24 08:57:08 |
| - | 2068742_MatoSpectoru_sticksthebadger_comm_fullcolor03fpslr.png | 851217 | 2025-06-24 08:57:08 |
| - | 2068743_MatoSpectoru_sticksthebadger_comm_fullcolor01bfpslr.json | 21577 | 2025-06-24 08:57:08 |
| - | 2068743_MatoSpectoru_sticksthebadger_comm_fullcolor01bfpslr.png | 742762 | 2025-06-24 08:57:08 |
| - | 2068746_MatoSpectoru_sticksthebadger_comm_fullcolor02bfpslr.json | 21577 | 2025-06-24 08:57:08 |
| - | 2068746_MatoSpectoru_sticksthebadger_comm_fullcolor02bfpslr.png | 765346 | 2025-06-24 08:57:08 |
| - | 2068750_MatoSpectoru_sticksthebadger_comm_fullcolor03bfpslr.json | 21577 | 2025-06-24 08:57:09 |
| - | 2068750_MatoSpectoru_sticksthebadger_comm_fullcolor03bfpslr.png | 830567 | 2025-06-24 08:57:09 |
| - | 2078402_MatoSpectoru_zeena_x_mina_-_fullcolor_commf001pslr.json | 20637 | 2025-07-27 03:24:47 |
| - | 2078402_MatoSpectoru_zeena_x_mina_-_fullcolor_commf001pslr.png | 1059362 | 2025-07-27 03:24:47 |
| - | 2078404_MatoSpectoru_zeena_x_mina_-_fullcolor_commf002pslr.json | 20637 | 2025-07-27 03:24:47 |
| - | 2078404_MatoSpectoru_zeena_x_mina_-_fullcolor_commf002pslr.png | 1060915 | 2025-07-27 03:24:47 |
| - | 2078407_MatoSpectoru_zeena_x_mina_-_fullcolor_commf003pslr.json | 20637 | 2025-07-27 03:24:47 |
| - | 2078407_MatoSpectoru_zeena_x_mina_-_fullcolor_commf003pslr.png | 1064163 | 2025-07-27 03:24:47 |
| - | 2078408_MatoSpectoru_zeena_x_mina_-_fullcolor_commf001pslrcumb.json | 20637 | 2025-07-27 03:24:48 |
| - | 2078408_MatoSpectoru_zeena_x_mina_-_fullcolor_commf001pslrcumb.png | 1094056 | 2025-07-27 03:24:48 |
| - | 2078410_MatoSpectoru_zeena_x_mina_-_fullcolor_commf002pslrcumb.json | 20637 | 2025-07-27 03:24:48 |
| - | 2078410_MatoSpectoru_zeena_x_mina_-_fullcolor_commf002pslrcumb.png | 1095132 | 2025-07-27 03:24:48 |
| - | 2078414_MatoSpectoru_zeena_x_mina_-_fullcolor_commf003pslrcumb.json | 20637 | 2025-07-27 03:24:48 |
| - | 2078414_MatoSpectoru_zeena_x_mina_-_fullcolor_commf003pslrcumb.png | 1104280 | 2025-07-27 03:24:48 |
| - | 2079605_MatoSpectoru_alice_x_nila_halloween_f2psxlr.json | 8512 | 2025-07-27 03:06:13 |
| - | 2079605_MatoSpectoru_alice_x_nila_halloween_f2psxlr.png | 1188488 | 2025-07-27 03:06:13 |
| - | 2089980_MatoSpectoru_fullcolor_-_rouge_x_tails_-_comm_fclrb.json | 7910 | 2025-07-27 00:33:22 |
| - | 2089980_MatoSpectoru_fullcolor_-_rouge_x_tails_-_comm_fclrb.png | 537828 | 2025-07-27 00:33:22 |
| - | 2097074_MatoSpectoru_aqualine_-_arttradebzeh_fps2lr2.json | 7629 | 2025-07-26 22:39:54 |
| - | 2097074_MatoSpectoru_aqualine_-_arttradebzeh_fps2lr2.png | 736959 | 2025-07-26 22:39:54 |
| - | 2102596_MatoSpectoru_fullcolorcroissantxrutmuttcommfcfpslr.json | 11225 | 2025-07-26 21:10:05 |
| - | 2102596_MatoSpectoru_fullcolorcroissantxrutmuttcommfcfpslr.png | 891527 | 2025-07-26 21:10:05 |
| - | 2102599_MatoSpectoru_fullcolorcroissantxrutmuttcommfcfpscumlr.json | 11225 | 2025-07-26 21:10:05 |
| - | 2102599_MatoSpectoru_fullcolorcroissantxrutmuttcommfcfpscumlr.png | 910506 | 2025-07-26 21:10:05 |
| - | 2130742_MatoSpectoru_flatcolorrougextailsfootlicking01fpsbnotextlr.json | 13227 | 2025-07-26 13:25:50 |
| - | 2130742_MatoSpectoru_flatcolorrougextailsfootlicking01fpsbnotextlr.png | 310130 | 2025-07-26 13:25:50 |
| - | 2130743_MatoSpectoru_flatcolorrougextailsfootlicking01fpsbtextlr.json | 13227 | 2025-07-26 13:25:51 |
| - | 2130743_MatoSpectoru_flatcolorrougextailsfootlicking01fpsbtextlr.png | 326448 | 2025-07-26 13:25:51 |
| - | 2130744_MatoSpectoru_flatcolorrougextailsfootlicking02fpsblr.json | 13227 | 2025-07-26 13:25:51 |
| - | 2130744_MatoSpectoru_flatcolorrougextailsfootlicking02fpsblr.png | 382850 | 2025-07-26 13:25:51 |
| - | 2140418_MatoSpectoru_fullcolordelphox2018psalr.json | 16022 | 2025-07-26 10:50:13 |
| - | 2140418_MatoSpectoru_fullcolordelphox2018psalr.png | 690306 | 2025-07-26 10:50:13 |
| - | 2140419_MatoSpectoru_fullcolordelphox2018psblr.json | 16022 | 2025-07-26 10:50:14 |
| - | 2140419_MatoSpectoru_fullcolordelphox2018psblr.png | 757918 | 2025-07-26 10:50:14 |
| - | 2140728_MatoSpectoru_fullcolordelphox2018psabnocumiblr.json | 16022 | 2025-07-26 10:50:14 |
| - | 2140728_MatoSpectoru_fullcolordelphox2018psabnocumiblr.png | 669610 | 2025-07-26 10:50:14 |
| - | 2140729_MatoSpectoru_fullcolordelphox2018psabcumiblr.json | 16022 | 2025-07-26 10:50:15 |
| - | 2140729_MatoSpectoru_fullcolordelphox2018psabcumiblr.png | 679892 | 2025-07-26 10:50:15 |
| - | 2143469_MatoSpectoru_fullcolorminniehapnincommpsf2lr.json | 7576 | 2025-07-26 09:55:57 |
| - | 2143469_MatoSpectoru_fullcolorminniehapnincommpsf2lr.png | 618138 | 2025-07-26 09:55:57 |
| - | 2151169_MatoSpectoru_karinbigheartocnsfwfpsxlr.json | 8405 | 2025-07-26 07:47:24 |
| - | 2151169_MatoSpectoru_karinbigheartocnsfwfpsxlr.png | 646411 | 2025-07-26 07:47:24 |
| - | 2184538_MatoSpectoru_midna_fcsplus2018_ffliplr2.0ib.json | 10882 | 2025-07-25 23:14:49 |
| - | 2184538_MatoSpectoru_midna_fcsplus2018_ffliplr2.0ib.png | 1500186 | 2025-07-25 23:14:49 |
| - | 2184539_MatoSpectoru_midna_fcsplus2018_fflipcumlr2.0ib.json | 10882 | 2025-07-25 23:14:49 |
| - | 2184539_MatoSpectoru_midna_fcsplus2018_fflipcumlr2.0ib.png | 1502977 | 2025-07-25 23:14:49 |
| - | 2184797_MatoSpectoru_privatecommissionfennecflatcolorfpslrb.json | 11932 | 2025-07-25 23:11:25 |
| - | 2184797_MatoSpectoru_privatecommissionfennecflatcolorfpslrb.png | 1114240 | 2025-07-25 23:11:25 |
| - | 2184798_MatoSpectoru_privatecommissionfennecflatcolorfpscumlrb.json | 11932 | 2025-07-25 23:11:26 |
| - | 2184798_MatoSpectoru_privatecommissionfennecflatcolorfpscumlrb.png | 1113829 | 2025-07-25 23:11:26 |
| - | 2189940_MatoSpectoru_panda_ocs_nsfw_fpslr.json | 15376 | 2025-07-25 21:51:19 |
| - | 2189940_MatoSpectoru_panda_ocs_nsfw_fpslr.png | 1297326 | 2025-07-25 21:51:19 |
| - | 2189943_MatoSpectoru_panda_ocs_nsfw_fps_leiyin_lr.json | 15376 | 2025-07-25 21:51:19 |
| - | 2189943_MatoSpectoru_panda_ocs_nsfw_fps_leiyin_lr.png | 734896 | 2025-07-25 21:51:19 |
| - | 2189946_MatoSpectoru_panda_ocs_nsfw_fps_mushi_lr.json | 15376 | 2025-07-25 21:51:19 |
| - | 2189946_MatoSpectoru_panda_ocs_nsfw_fps_mushi_lr.png | 616430 | 2025-07-25 21:51:19 |
| - | 2189947_MatoSpectoru_panda_ocs_nsfw_fps_huimin_lr.json | 15376 | 2025-07-25 21:51:19 |
| - | 2189947_MatoSpectoru_panda_ocs_nsfw_fps_huimin_lr.png | 576864 | 2025-07-25 21:51:19 |
| - | 2190725_MatoSpectoru_commissions_info_2018_-_round_1_pslr.json | 28294 | 2025-07-25 21:38:07 |
| - | 2190725_MatoSpectoru_commissions_info_2018_-_round_1_pslr.png | 2593756 | 2025-07-25 21:38:07 |
| - | 2190759_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_full_color.json | 28294 | 2025-07-25 21:38:07 |
| - | 2190759_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_full_color.png | 4597408 | 2025-07-25 21:38:07 |
| - | 2190763_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_flat_color.json | 28294 | 2025-07-25 21:38:07 |
| - | 2190763_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_flat_color.png | 1717766 | 2025-07-25 21:38:07 |
| - | 2190777_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_sketch.json | 28294 | 2025-07-25 21:38:07 |
| - | 2190777_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_sketch.png | 1614298 | 2025-07-25 21:38:07 |
| - | 2190790_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_mlp.json | 28294 | 2025-07-25 21:38:08 |
| - | 2190790_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_mlp.png | 5638961 | 2025-07-25 21:38:08 |
| - | 2190791_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_my_ocs_nsfw.json | 28294 | 2025-07-25 21:38:09 |
| - | 2190791_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_my_ocs_nsfw.png | 4914577 | 2025-07-25 21:38:09 |
| - | 2190794_MatoSpectoru_commissions_info_2018_-_round_1_ps_contact_info.json | 28294 | 2025-07-25 21:38:10 |
| - | 2190794_MatoSpectoru_commissions_info_2018_-_round_1_ps_contact_info.png | 551686 | 2025-07-25 21:38:10 |
| - | 2194966_MatoSpectoru_mu-shi_x_hyper_rutmutt_sketch_f01pslr.json | 20701 | 2025-07-25 20:18:41 |
| - | 2194966_MatoSpectoru_mu-shi_x_hyper_rutmutt_sketch_f01pslr.png | 219676 | 2025-07-25 20:18:41 |
| - | 2194968_MatoSpectoru_mu-shi_x_hyper_rutmutt_sketch_f02pslr.json | 20701 | 2025-07-25 20:18:41 |
| - | 2194968_MatoSpectoru_mu-shi_x_hyper_rutmutt_sketch_f02pslr.png | 265034 | 2025-07-25 20:18:41 |
| - | 2194970_MatoSpectoru_hui-min_x_hyper_rutmutt_sketchcomm_01bpslr.json | 20701 | 2025-07-25 20:18:41 |
| - | 2194970_MatoSpectoru_hui-min_x_hyper_rutmutt_sketchcomm_01bpslr.png | 233926 | 2025-07-25 20:18:41 |
| - | 2194972_MatoSpectoru_hui-min_x_hyper_rutmutt_sketchcomm_02bpslrcumf.json | 20701 | 2025-07-25 20:18:41 |
| - | 2194972_MatoSpectoru_hui-min_x_hyper_rutmutt_sketchcomm_02bpslrcumf.png | 234356 | 2025-07-25 20:18:41 |
| - | 2195142_MatoSpectoru_mu-shi_x_hyper_rutmutt_sketch_02f_01fpslr2.0.json | 20701 | 2025-07-25 20:18:41 |
| - | 2195142_MatoSpectoru_mu-shi_x_hyper_rutmutt_sketch_02f_01fpslr2.0.png | 347027 | 2025-07-25 20:18:41 |
| - | 2195143_MatoSpectoru_mu-shi_x_hyper_rutmutt_sketch_02f_02fpslr2.0.json | 20701 | 2025-07-25 20:18:42 |
| - | 2195143_MatoSpectoru_mu-shi_x_hyper_rutmutt_sketch_02f_02fpslr2.0.png | 390389 | 2025-07-25 20:18:42 |
| - | 2196939_MatoSpectoru_missysketchcomm01pslr.json | 12803 | 2025-07-25 19:45:57 |
| - | 2196939_MatoSpectoru_missysketchcomm01pslr.png | 137115 | 2025-07-25 19:45:57 |
| - | 2196947_MatoSpectoru_missysketchcomm02pslr.json | 12803 | 2025-07-25 19:45:57 |
| - | 2196947_MatoSpectoru_missysketchcomm02pslr.png | 146933 | 2025-07-25 19:45:57 |
| - | 2196951_MatoSpectoru_missysketchcomm02cumpslr.json | 12803 | 2025-07-25 19:45:57 |
| - | 2196951_MatoSpectoru_missysketchcomm02cumpslr.png | 158340 | 2025-07-25 19:45:57 |
| - | 2198897_MatoSpectoru_leixleiyinsketchcomm01pslr.json | 11395 | 2025-07-25 19:15:16 |
| - | 2198897_MatoSpectoru_leixleiyinsketchcomm01pslr.png | 245514 | 2025-07-25 19:15:16 |
| - | 2198900_MatoSpectoru_leixleiyinsketchcomm02pslr.json | 11395 | 2025-07-25 19:15:16 |
| - | 2198900_MatoSpectoru_leixleiyinsketchcomm02pslr.png | 309837 | 2025-07-25 19:15:16 |
| - | 2203041_MatoSpectoru_queen_novo_fullcolorcommf01psblr.json | 11771 | 2025-07-25 18:13:49 |
| - | 2203041_MatoSpectoru_queen_novo_fullcolorcommf01psblr.png | 621485 | 2025-07-25 18:13:49 |
| - | 2203042_MatoSpectoru_queen_novo_fullcolorcommf02pslr.json | 11771 | 2025-07-25 18:13:49 |
| - | 2203042_MatoSpectoru_queen_novo_fullcolorcommf02pslr.png | 586848 | 2025-07-25 18:13:49 |
| - | 2210127_MatoSpectoru_leiyinxhuiminfullcolorcommfpsb_csp_e_textlr.json | 13509 | 2025-07-25 16:07:07 |
| - | 2210127_MatoSpectoru_leiyinxhuiminfullcolorcommfpsb_csp_e_textlr.png | 776090 | 2025-07-25 16:07:07 |
| - | 2210130_MatoSpectoru_leiyinxhuiminfullcolorcommfpsblr.json | 13509 | 2025-07-25 16:07:08 |
| - | 2210130_MatoSpectoru_leiyinxhuiminfullcolorcommfpsblr.png | 730116 | 2025-07-25 16:07:08 |
| - | 2236868_MatoSpectoru_canutteberryfullcolorcommpsf2lr.json | 13737 | 2025-07-25 09:07:52 |
| - | 2236868_MatoSpectoru_canutteberryfullcolorcommpsf2lr.png | 733722 | 2025-07-25 09:07:52 |
| - | 2236869_MatoSpectoru_canutteberryfullcolorcommpsf2cumlr.json | 13737 | 2025-07-25 09:07:52 |
| - | 2236869_MatoSpectoru_canutteberryfullcolorcommpsf2cumlr.png | 756743 | 2025-07-25 09:07:52 |
| - | 2254719_MatoSpectoru_saikaxalicesheepstarcommpsfrlrc.json | 10382 | 2025-07-25 04:31:48 |
| - | 2254719_MatoSpectoru_saikaxalicesheepstarcommpsfrlrc.png | 621765 | 2025-07-25 04:31:48 |
| - | 2260054_MatoSpectoru_kimi_yagami_flatcolorcomm_fpslr.json | 10938 | 2025-07-25 03:12:22 |
| - | 2260054_MatoSpectoru_kimi_yagami_flatcolorcomm_fpslr.png | 1719697 | 2025-07-25 03:12:22 |
| - | 2260055_MatoSpectoru_kimi_yagami_flatcolorcomm_fcumpslr.json | 10938 | 2025-07-25 03:12:22 |
| - | 2260055_MatoSpectoru_kimi_yagami_flatcolorcomm_fcumpslr.png | 1401121 | 2025-07-25 03:12:22 |
| - | 2260229_MatoSpectoru_nilasternxleiyinfullcolorcommfpslr001.json | 17459 | 2025-07-25 03:09:35 |
| - | 2260229_MatoSpectoru_nilasternxleiyinfullcolorcommfpslr001.png | 1003474 | 2025-07-25 03:09:35 |
| - | 2260235_MatoSpectoru_nilasternxleiyinfullcolorcommfpslr003.json | 17459 | 2025-07-25 03:09:35 |
| - | 2260235_MatoSpectoru_nilasternxleiyinfullcolorcommfpslr003.png | 1067545 | 2025-07-25 03:09:35 |
| - | 2260236_MatoSpectoru_nilasternxleiyinfullcolorcommfpslr002.json | 17459 | 2025-07-25 03:09:36 |
| - | 2260236_MatoSpectoru_nilasternxleiyinfullcolorcommfpslr002.png | 1183329 | 2025-07-25 03:09:36 |
| - | 2260237_MatoSpectoru_nilasternxleiyinfullcolorcommfpslr004.json | 17459 | 2025-07-25 03:09:36 |
| - | 2260237_MatoSpectoru_nilasternxleiyinfullcolorcommfpslr004.png | 1264737 | 2025-07-25 03:09:36 |
| - | 2264095_MatoSpectoru_kimiyagamiflatcolorcommfbpsf001alr.json | 17978 | 2025-07-25 02:15:44 |
| - | 2264095_MatoSpectoru_kimiyagamiflatcolorcommfbpsf001alr.png | 288993 | 2025-07-25 02:15:44 |
| - | 2264098_MatoSpectoru_kimiyagamiflatcolorcommfbpsf001blr.json | 17978 | 2025-07-25 02:15:44 |
| - | 2264098_MatoSpectoru_kimiyagamiflatcolorcommfbpsf001blr.png | 292063 | 2025-07-25 02:15:44 |
| - | 2264099_MatoSpectoru_kimiyagamiflatcolorcommfbpsf002alr.json | 17978 | 2025-07-25 02:15:45 |
| - | 2264099_MatoSpectoru_kimiyagamiflatcolorcommfbpsf002alr.png | 308933 | 2025-07-25 02:15:45 |
| - | 2264100_MatoSpectoru_kimiyagamiflatcolorcommfbpsf002blr.json | 17978 | 2025-07-25 02:15:45 |
| - | 2264100_MatoSpectoru_kimiyagamiflatcolorcommfbpsf002blr.png | 355616 | 2025-07-25 02:15:45 |
| - | 2264101_MatoSpectoru_kimiyagamiflatcolorcommfbpsf003lr.json | 17978 | 2025-07-25 02:15:45 |
| - | 2264101_MatoSpectoru_kimiyagamiflatcolorcommfbpsf003lr.png | 240986 | 2025-07-25 02:15:45 |
| - | 2270833_MatoSpectoru_commissions_info_2018_-_round_2_full_lr.json | 29354 | 2025-07-25 00:39:38 |
| - | 2270833_MatoSpectoru_commissions_info_2018_-_round_2_full_lr.png | 1900875 | 2025-07-25 00:39:38 |
| - | 2270861_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_full_color_twitter2.0_crop.json | 29354 | 2025-07-25 00:39:38 |
| - | 2270861_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_full_color_twitter2.0_crop.png | 4597175 | 2025-07-25 00:39:38 |
| - | 2270863_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_flat_color.json | 29354 | 2025-07-25 00:39:39 |
| - | 2270863_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_flat_color.png | 1717766 | 2025-07-25 00:39:39 |
| - | 2270865_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_sketch.json | 29354 | 2025-07-25 00:39:39 |
| - | 2270865_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_sketch.png | 1614298 | 2025-07-25 00:39:39 |
| - | 2270866_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_mlp.json | 29354 | 2025-07-25 00:39:39 |
| - | 2270866_MatoSpectoru_commissions_info_2018_-_round_1_ps_-_mlp.png | 5638961 | 2025-07-25 00:39:39 |
| - | 2270869_MatoSpectoru_commissions_info_2018_-_round_2_ps_-_my_ocs_nsfw_2.0.json | 29354 | 2025-07-25 00:39:41 |
| - | 2270869_MatoSpectoru_commissions_info_2018_-_round_2_ps_-_my_ocs_nsfw_2.0.png | 7417632 | 2025-07-25 00:39:41 |
| - | 2270946_MatoSpectoru_commissions_info_2018_-_round_2_2.0.json | 29354 | 2025-07-25 00:39:41 |
| - | 2270946_MatoSpectoru_commissions_info_2018_-_round_2_2.0.png | 543528 | 2025-07-25 00:39:41 |
| - | 2279700_MatoSpectoru_kimiyagamicharactersheetfpslrname2.0.json | 8465 | 2025-07-24 22:28:28 |
| - | 2279700_MatoSpectoru_kimiyagamicharactersheetfpslrname2.0.png | 1324121 | 2025-07-24 22:28:28 |
| - | 2286799_MatoSpectoru_fullcolorbobbimaehamptoncommfullcolorfpslr.json | 8189 | 2025-07-24 20:32:32 |
| - | 2286799_MatoSpectoru_fullcolorbobbimaehamptoncommfullcolorfpslr.png | 490414 | 2025-07-24 20:32:32 |
| - | 2303253_MatoSpectoru_fullcolorklarachameleonesscommfpsflr.json | 9128 | 2025-07-24 16:21:14 |
| - | 2303253_MatoSpectoru_fullcolorklarachameleonesscommfpsflr.png | 691262 | 2025-07-24 16:21:14 |
| - | 2306560_MatoSpectoru_fullcolorbluethedogcommfpsfxlr.json | 8340 | 2025-07-24 15:32:13 |
| - | 2306560_MatoSpectoru_fullcolorbluethedogcommfpsfxlr.png | 736020 | 2025-07-24 15:32:13 |
| - | 2311364_MatoSpectoru_springtherabbit10sketchcommfullcolorfps3.5lr.json | 11723 | 2025-07-24 14:28:53 |
| - | 2311364_MatoSpectoru_springtherabbit10sketchcommfullcolorfps3.5lr.png | 681963 | 2025-07-24 14:28:53 |
| - | 2311365_MatoSpectoru_springtherabbit10sketchcommfullcolorfpscum3.5lr.json | 11723 | 2025-07-24 14:28:53 |
| - | 2311365_MatoSpectoru_springtherabbit10sketchcommfullcolorfpscum3.5lr.png | 690054 | 2025-07-24 14:28:53 |
| - | 2323788_MatoSpectoru_fullcolortorielbreastexpansioncommfpsflr2.0.json | 9001 | 2025-07-24 11:19:02 |
| - | 2323788_MatoSpectoru_fullcolortorielbreastexpansioncommfpsflr2.0.png | 634340 | 2025-07-24 11:19:02 |
| - | 2326579_MatoSpectoru_fullcolorabigailwhitecommftpslr.json | 7253 | 2025-07-24 10:29:31 |
| - | 2326579_MatoSpectoru_fullcolorabigailwhitecommftpslr.png | 1473563 | 2025-07-24 10:29:31 |
| - | 2332651_MatoSpectoru_fullcolortonilizardgirlcommfpslr2.0.json | 8071 | 2025-07-24 08:47:55 |
| - | 2332651_MatoSpectoru_fullcolortonilizardgirlcommfpslr2.0.png | 804225 | 2025-07-24 08:47:55 |
| - | 2333447_MatoSpectoru_fullcolorpoppyxraidragonscommf01bfpslr.json | 12118 | 2025-07-24 08:34:11 |
| - | 2333447_MatoSpectoru_fullcolorpoppyxraidragonscommf01bfpslr.png | 691012 | 2025-07-24 08:34:11 |
| - | 2333448_MatoSpectoru_fullcolorpoppyxraidragonscommf02bfpslr.json | 12118 | 2025-07-24 08:34:12 |
| - | 2333448_MatoSpectoru_fullcolorpoppyxraidragonscommf02bfpslr.png | 667947 | 2025-07-24 08:34:12 |
| - | 2337804_MatoSpectoru_alicesheepstarlr0001_0000s_0004_hat-original-01.json | 17175 | 2025-07-24 07:26:53 |
| - | 2337804_MatoSpectoru_alicesheepstarlr0001_0000s_0004_hat-original-01.png | 547851 | 2025-07-24 07:26:53 |
| - | 2337807_MatoSpectoru_alicesheepstarlr0001_0000s_0003_hat-original-02.json | 17175 | 2025-07-24 07:26:54 |
| - | 2337807_MatoSpectoru_alicesheepstarlr0001_0000s_0003_hat-original-02.png | 609169 | 2025-07-24 07:26:54 |
| - | 2337809_MatoSpectoru_alicesheepstarlr0001_0002s_0000_original-01.json | 17175 | 2025-07-24 07:26:54 |
| - | 2337809_MatoSpectoru_alicesheepstarlr0001_0002s_0000_original-01.png | 434244 | 2025-07-24 07:26:54 |
| - | 2337811_MatoSpectoru_alicesheepstarlr0001_0002s_0001_original-02.json | 17175 | 2025-07-24 07:26:54 |
| - | 2337811_MatoSpectoru_alicesheepstarlr0001_0002s_0001_original-02.png | 497300 | 2025-07-24 07:26:54 |
| - | 2341494_MatoSpectoru_sketchsaikaxmiyakocommfps01lrb.json | 9108 | 2025-07-24 06:28:14 |
| - | 2341494_MatoSpectoru_sketchsaikaxmiyakocommfps01lrb.png | 671696 | 2025-07-24 06:28:14 |
| - | 2344828_MatoSpectoru_sketchrougethebatxshadetheechidnacommffpslr.json | 13664 | 2025-07-24 05:34:50 |
| - | 2344828_MatoSpectoru_sketchrougethebatxshadetheechidnacommffpslr.png | 313216 | 2025-07-24 05:34:50 |
| - | 2344831_MatoSpectoru_sketchtshadetheechidnaxknucklestheechidnalr3.0f.json | 13664 | 2025-07-24 05:34:50 |
| - | 2344831_MatoSpectoru_sketchtshadetheechidnaxknucklestheechidnalr3.0f.png | 202597 | 2025-07-24 05:34:50 |
| - | 2344832_MatoSpectoru_sketchrougethebatxknucklestheechidnalr5.0f.json | 13664 | 2025-07-24 05:34:50 |
| - | 2344832_MatoSpectoru_sketchrougethebatxknucklestheechidnalr5.0f.png | 362504 | 2025-07-24 05:34:50 |
| - | 2369265_MatoSpectoru_fullcolormidnadakimakuracommfps2.0_watermark_lr.json | 8565 | 2025-07-23 23:11:14 |
| - | 2369265_MatoSpectoru_fullcolormidnadakimakuracommfps2.0_watermark_lr.png | 840449 | 2025-07-23 23:11:14 |
| - | 2369267_MatoSpectoru_hypermidnacommpsf3.0lr.json | 8915 | 2025-07-23 23:11:12 |
| - | 2369267_MatoSpectoru_hypermidnacommpsf3.0lr.png | 1205373 | 2025-07-23 23:11:12 |
| - | 2369268_MatoSpectoru_fullcolortiffanycommfpslrb.json | 10951 | 2025-07-23 23:11:11 |
| - | 2369268_MatoSpectoru_fullcolortiffanycommfpslrb.png | 725317 | 2025-07-23 23:11:11 |
| - | 2369269_MatoSpectoru_fullcolortiffanycommfpsmilklrb.json | 10951 | 2025-07-23 23:11:11 |
| - | 2369269_MatoSpectoru_fullcolortiffanycommfpsmilklrb.png | 751565 | 2025-07-23 23:11:11 |
| - | 2369987_MatoSpectoru_ocs_nsfw_choose_pslrvote.json | 20718 | 2025-07-23 22:59:18 |
| - | 2369987_MatoSpectoru_ocs_nsfw_choose_pslrvote.png | 975252 | 2025-07-23 22:59:18 |
| - | 2369991_MatoSpectoru_ocs_nsfw_choose_nila_stern_lr.json | 20718 | 2025-07-23 22:59:18 |
| - | 2369991_MatoSpectoru_ocs_nsfw_choose_nila_stern_lr.png | 294748 | 2025-07-23 22:59:18 |
| - | 2369992_MatoSpectoru_ocs_nsfw_choose_alice_sheepstar_lr.json | 20718 | 2025-07-23 22:59:18 |
| - | 2369992_MatoSpectoru_ocs_nsfw_choose_alice_sheepstar_lr.png | 304044 | 2025-07-23 22:59:18 |
| - | 2369994_MatoSpectoru_ocs_nsfw_choose_karin_bigheart_lr.json | 20718 | 2025-07-23 22:59:18 |
| - | 2369994_MatoSpectoru_ocs_nsfw_choose_karin_bigheart_lr.png | 248074 | 2025-07-23 22:59:18 |
| - | 2369995_MatoSpectoru_ocs_nsfw_choose_lei-yin_lr.json | 20718 | 2025-07-23 22:59:18 |
| - | 2369995_MatoSpectoru_ocs_nsfw_choose_lei-yin_lr.png | 441247 | 2025-07-23 22:59:18 |
| - | 2369996_MatoSpectoru_ocs_nsfw_choose_mu-shi_lr.json | 20718 | 2025-07-23 22:59:19 |
| - | 2369996_MatoSpectoru_ocs_nsfw_choose_mu-shi_lr.png | 701393 | 2025-07-23 22:59:19 |
| - | 2369998_MatoSpectoru_ocs_nsfw_choose_hui-min_lr.json | 20718 | 2025-07-23 22:59:20 |
| - | 2369998_MatoSpectoru_ocs_nsfw_choose_hui-min_lr.png | 878381 | 2025-07-23 22:59:20 |
| - | 2374029_MatoSpectoru_patreonisherelr.json | 7140 | 2025-07-23 21:54:07 |
| - | 2374029_MatoSpectoru_patreonisherelr.png | 630883 | 2025-07-23 21:54:07 |
| - | 2380352_MatoSpectoru_poppylastfcs-fullcolorfnopubichairflr.json | 11599 | 2025-07-23 19:59:35 |
| - | 2380352_MatoSpectoru_poppylastfcs-fullcolorfnopubichairflr.png | 544034 | 2025-07-23 19:59:35 |
| - | 2380353_MatoSpectoru_poppylastfcs-fullcolorfflr.json | 11599 | 2025-07-23 19:59:35 |
| - | 2380353_MatoSpectoru_poppylastfcs-fullcolorfflr.png | 546782 | 2025-07-23 19:59:35 |
| - | 2385564_MatoSpectoru_fullcolorskylaflygoncomma-blr_01.json | 10359 | 2025-07-23 18:38:50 |
| - | 2385564_MatoSpectoru_fullcolorskylaflygoncomma-blr_01.png | 543156 | 2025-07-23 18:38:50 |
| - | 2385588_MatoSpectoru_fullcolorskylaflygoncomma-blr_02.json | 10359 | 2025-07-23 18:38:51 |
| - | 2385588_MatoSpectoru_fullcolorskylaflygoncomma-blr_02.png | 543531 | 2025-07-23 18:38:51 |
| - | 2387443_MatoSpectoru_discordgrp.json | 8087 | 2025-07-23 18:07:47 |
| - | 2387443_MatoSpectoru_discordgrp.png | 169034 | 2025-07-23 18:07:47 |
| - | 2391761_MatoSpectoru_fiera-apegacinepatreoncommfullcolorlr04.json | 7701 | 2025-07-23 16:26:14 |
| - | 2391761_MatoSpectoru_fiera-apegacinepatreoncommfullcolorlr04.png | 622763 | 2025-07-23 16:26:14 |
| - | 2392770_MatoSpectoru_midnaspreadpussyremake2018goodcropfpsfinallr.json | 10628 | 2025-07-23 16:09:31 |
| - | 2392770_MatoSpectoru_midnaspreadpussyremake2018goodcropfpsfinallr.png | 1067221 | 2025-07-23 16:09:31 |
| - | 2394509_MatoSpectoru_fullcolor-xyphyth-unicornvampireponycomm01psclr.json | 11068 | 2025-07-23 15:40:27 |
| - | 2394509_MatoSpectoru_fullcolor-xyphyth-unicornvampireponycomm01psclr.png | 582388 | 2025-07-23 15:40:27 |
| - | 2394522_MatoSpectoru_fullcolor-xyphyth-unicornvampireponycomm02psclr.json | 11068 | 2025-07-23 15:40:28 |
| - | 2394522_MatoSpectoru_fullcolor-xyphyth-unicornvampireponycomm02psclr.png | 599244 | 2025-07-23 15:40:28 |
| - | 2403807_MatoSpectoru_004fullcolorazureaurafursonacommfcroppsfullcolor.json | 8199 | 2025-07-23 13:08:34 |
| - | 2403807_MatoSpectoru_004fullcolorazureaurafursonacommfcroppsfullcolor.png | 510364 | 2025-07-23 13:08:34 |
| - | 2405083_MatoSpectoru_004fullcolor-femalelucario-commfullcolorfpshr.json | 8056 | 2025-07-23 12:52:08 |
| - | 2405083_MatoSpectoru_004fullcolor-femalelucario-commfullcolorfpshr.png | 564295 | 2025-07-23 12:52:08 |
| - | 2406118_MatoSpectoru_004fullcolormushixpancommfullcolorfpsf3move.json | 12428 | 2025-07-23 12:35:34 |
| - | 2406118_MatoSpectoru_004fullcolormushixpancommfullcolorfpsf3move.png | 635946 | 2025-07-23 12:35:34 |
| - | 2406119_MatoSpectoru_004fullcolormushixpancommfullcolorfpsf3cum.json | 12428 | 2025-07-23 12:35:34 |
| - | 2406119_MatoSpectoru_004fullcolormushixpancommfullcolorfpsf3cum.png | 639121 | 2025-07-23 12:35:34 |
| - | 2408056_MatoSpectoru_leiyinpatreoncommcompilationfpsretouchf_00.json | 8813 | 2025-07-23 12:02:40 |
| - | 2408056_MatoSpectoru_leiyinpatreoncommcompilationfpsretouchf_00.png | 852471 | 2025-07-23 12:02:40 |
| - | 2408215_MatoSpectoru_spyro_reignited_elorafcropbpslr.json | 8954 | 2025-07-23 12:00:09 |
| - | 2408215_MatoSpectoru_spyro_reignited_elorafcropbpslr.png | 763239 | 2025-07-23 12:00:09 |
| - | 2408632_MatoSpectoru_003_spyro_reignited_elora_x_spyrofpsfullcolorlr.json | 8727 | 2025-07-23 11:51:58 |
| - | 2408632_MatoSpectoru_003_spyro_reignited_elora_x_spyrofpsfullcolorlr.png | 783640 | 2025-07-23 11:51:58 |
| - | 2410487_MatoSpectoru_kannapatreoncommmichaelrobinsonfullcolorfpscensored.json | 8071 | 2025-07-23 11:22:37 |
| - | 2410487_MatoSpectoru_kannapatreoncommmichaelrobinsonfullcolorfpscensored.png | 561526 | 2025-07-23 11:22:37 |
| - | 2411933_MatoSpectoru_004midnapatreoncommasaskumefullcolorfpsf.json | 9041 | 2025-07-23 10:49:55 |
| - | 2411933_MatoSpectoru_004midnapatreoncommasaskumefullcolorfpsf.png | 377186 | 2025-07-23 10:49:55 |
| - | 2422957_MatoSpectoru_004fullcolorhuiminxayakocommfpsnormallr.json | 12477 | 2025-07-23 07:48:49 |
| - | 2422957_MatoSpectoru_004fullcolorhuiminxayakocommfpsnormallr.png | 867384 | 2025-07-23 07:48:49 |
| - | 2422959_MatoSpectoru_005fullcolorhuiminxayakocommfpscumlr.json | 12477 | 2025-07-23 07:48:50 |
| - | 2422959_MatoSpectoru_005fullcolorhuiminxayakocommfpscumlr.png | 877856 | 2025-07-23 07:48:50 |
| - | 2425902_MatoSpectoru_004fullcolorsallyacornxfionafoxcommf01fpslr.json | 11477 | 2025-07-23 07:03:56 |
| - | 2425902_MatoSpectoru_004fullcolorsallyacornxfionafoxcommf01fpslr.png | 478569 | 2025-07-23 07:03:56 |
| - | 2425904_MatoSpectoru_004fullcolorsallyacornxfionafoxcommf01fpsnoboxlr.json | 11477 | 2025-07-23 07:03:56 |
| - | 2425904_MatoSpectoru_004fullcolorsallyacornxfionafoxcommf01fpsnoboxlr.png | 452978 | 2025-07-23 07:03:56 |
| - | 2427702_MatoSpectoru_004flatcolorrenard-homurarenardcommfullcolorpsflr.json | 7418 | 2025-07-23 06:36:12 |
| - | 2427702_MatoSpectoru_004flatcolorrenard-homurarenardcommfullcolorpsflr.png | 755016 | 2025-07-23 06:36:12 |
| - | 2433092_MatoSpectoru_sonicxzooeycommsketchlr.json | 7983 | 2025-07-23 05:09:59 |
| - | 2433092_MatoSpectoru_sonicxzooeycommsketchlr.png | 288097 | 2025-07-23 05:09:59 |
| - | 2433096_MatoSpectoru_004fullcolorazureaura2fursonacommfullcolorlr.json | 8839 | 2025-07-23 05:09:55 |
| - | 2433096_MatoSpectoru_004fullcolorazureaura2fursonacommfullcolorlr.png | 438051 | 2025-07-23 05:09:55 |
| - | 2433322_MatoSpectoru_004fullcolorportiapiercecommfullcolorpslr.json | 7532 | 2025-07-23 05:06:23 |
| - | 2433322_MatoSpectoru_004fullcolorportiapiercecommfullcolorpslr.png | 777731 | 2025-07-23 05:06:23 |
| - | 2436019_MatoSpectoru_001isabellenew2018suit01lr.json | 14219 | 2025-07-23 04:23:18 |
| - | 2436019_MatoSpectoru_001isabellenew2018suit01lr.png | 798022 | 2025-07-23 04:23:18 |
| - | 2436020_MatoSpectoru_001isabellenew2018suit01glr.json | 14219 | 2025-07-23 04:23:18 |
| - | 2436020_MatoSpectoru_001isabellenew2018suit01glr.png | 824729 | 2025-07-23 04:23:18 |
| - | 2436022_MatoSpectoru_004isabellenew2018nakedlr.json | 14219 | 2025-07-23 04:23:18 |
| - | 2436022_MatoSpectoru_004isabellenew2018nakedlr.png | 618086 | 2025-07-23 04:23:18 |
| - | 2440489_MatoSpectoru_004huiminpatreoncommffullcolorpslr.json | 8115 | 2025-07-23 03:12:15 |
| - | 2440489_MatoSpectoru_004huiminpatreoncommffullcolorpslr.png | 494494 | 2025-07-23 03:12:15 |
| - | 2442971_MatoSpectoru_004hermrosetentaclepatreoncommfullcolorpslr.json | 8057 | 2025-07-23 02:34:36 |
| - | 2442971_MatoSpectoru_004hermrosetentaclepatreoncommfullcolorpslr.png | 806687 | 2025-07-23 02:34:36 |
| - | 2443773_MatoSpectoru_004renamonmonthlypollseptemberpatreonffullcolorpslr.json | 8689 | 2025-07-23 02:22:03 |
| - | 2443773_MatoSpectoru_004renamonmonthlypollseptemberpatreonffullcolorpslr.png | 729955 | 2025-07-23 02:22:03 |
| - | 2448049_MatoSpectoru_commoctober2018round3inkbunny.json | 22705 | 2025-07-23 01:16:40 |
| - | 2448049_MatoSpectoru_commoctober2018round3inkbunny.png | 15117239 | 2025-07-23 01:16:40 |
| - | 2448062_MatoSpectoru_commoctober2018round3fullcolorflatcolor.json | 22705 | 2025-07-23 01:16:40 |
| - | 2448062_MatoSpectoru_commoctober2018round3fullcolorflatcolor.png | 4831895 | 2025-07-23 01:16:40 |
| - | 2448089_MatoSpectoru_commoctober2018round3sketchmlp.json | 22705 | 2025-07-23 01:16:41 |
| - | 2448089_MatoSpectoru_commoctober2018round3sketchmlp.png | 5407745 | 2025-07-23 01:16:41 |
| - | 2448109_MatoSpectoru_commoctober2018round3ocs.json | 22705 | 2025-07-23 01:16:41 |
| - | 2448109_MatoSpectoru_commoctober2018round3ocs.png | 4673263 | 2025-07-23 01:16:41 |
| - | 2462846_MatoSpectoru_fullcolorhoraecommfpackpsflr2.0.json | 7345 | 2025-07-22 21:14:24 |
| - | 2462846_MatoSpectoru_fullcolorhoraecommfpackpsflr2.0.png | 625691 | 2025-07-22 21:14:24 |
| - | 2465903_MatoSpectoru_004afullcolormrsshyanthroponycommglassespslr.json | 13523 | 2025-07-22 20:23:37 |
| - | 2465903_MatoSpectoru_004afullcolormrsshyanthroponycommglassespslr.png | 865800 | 2025-07-22 20:23:37 |
| - | 2465904_MatoSpectoru_004bfullcolormrsshyanthroponycommwithoutglassespslr.json | 13523 | 2025-07-22 20:23:37 |
| - | 2465904_MatoSpectoru_004bfullcolormrsshyanthroponycommwithoutglassespslr.png | 859643 | 2025-07-22 20:23:37 |
| - | 2466846_MatoSpectoru_004patreoncommmidnatsuyuasuioutfitfps2.0lr.json | 9037 | 2025-07-22 20:07:40 |
| - | 2466846_MatoSpectoru_004patreoncommmidnatsuyuasuioutfitfps2.0lr.png | 829950 | 2025-07-22 20:07:40 |
| - | 2469859_MatoSpectoru_004kenza-apegacinepatreoncommffullcolorpslr.json | 7973 | 2025-07-22 19:17:22 |
| - | 2469859_MatoSpectoru_004kenza-apegacinepatreoncommffullcolorpslr.png | 568770 | 2025-07-22 19:17:22 |
| - | 2470352_MatoSpectoru_003flatcolorchibicharacterfyratrosecommflatcolorpslr.json | 7467 | 2025-07-22 19:09:15 |
| - | 2470352_MatoSpectoru_003flatcolorchibicharacterfyratrosecommflatcolorpslr.png | 302713 | 2025-07-22 19:09:15 |
| - | 2482268_MatoSpectoru_madmewmewbust2018suit02pslr.json | 20525 | 2025-07-22 15:39:35 |
| - | 2482268_MatoSpectoru_madmewmewbust2018suit02pslr.png | 515441 | 2025-07-22 15:39:35 |
| - | 2482269_MatoSpectoru_madmewmewbust2018naked02pslr.json | 20525 | 2025-07-22 15:39:35 |
| - | 2482269_MatoSpectoru_madmewmewbust2018naked02pslr.png | 508195 | 2025-07-22 15:39:35 |
| - | 2482270_MatoSpectoru_madmewmewbust2018suit01pslr.json | 20525 | 2025-07-22 15:39:35 |
| - | 2482270_MatoSpectoru_madmewmewbust2018suit01pslr.png | 516130 | 2025-07-22 15:39:35 |
| - | 2482271_MatoSpectoru_madmewmewbust2018naked01pslr.json | 20525 | 2025-07-22 15:39:36 |
| - | 2482271_MatoSpectoru_madmewmewbust2018naked01pslr.png | 474727 | 2025-07-22 15:39:36 |
| - | 2484166_MatoSpectoru_004hbss2koboldfps2.0.json | 9236 | 2025-07-22 15:07:20 |
| - | 2484166_MatoSpectoru_004hbss2koboldfps2.0.png | 822245 | 2025-07-22 15:07:20 |
| - | 2486495_MatoSpectoru_004fullcolorzoeyshortstackcommfpsbbackgroundpatreonlogolr.json | 12040 | 2025-07-22 14:30:01 |
| - | 2486495_MatoSpectoru_004fullcolorzoeyshortstackcommfpsbbackgroundpatreonlogolr.png | 1147066 | 2025-07-22 14:30:01 |
| - | 2486496_MatoSpectoru_004fullcolorzoeyshortstackcommfpsblr.json | 12040 | 2025-07-22 14:30:02 |
| - | 2486496_MatoSpectoru_004fullcolorzoeyshortstackcommfpsblr.png | 471500 | 2025-07-22 14:30:02 |
| - | 2487273_MatoSpectoru_004bblazexrougepatreoncommf2psfaltlogo.json | 12514 | 2025-07-22 14:17:23 |
| - | 2487273_MatoSpectoru_004bblazexrougepatreoncommf2psfaltlogo.png | 868799 | 2025-07-22 14:17:23 |
| - | 2487275_MatoSpectoru_004ablazexrougepatreoncommf2psflogo.json | 12514 | 2025-07-22 14:17:23 |
| - | 2487275_MatoSpectoru_004ablazexrougepatreoncommf2psflogo.png | 872141 | 2025-07-22 14:17:23 |
| - | 2488393_MatoSpectoru_madmewmewbust2018naked02psbonusb.json | 20525 | 2025-07-22 15:39:36 |
| - | 2488393_MatoSpectoru_madmewmewbust2018naked02psbonusb.png | 525942 | 2025-07-22 15:39:36 |
| - | 2488396_MatoSpectoru_madmewmewbust2018naked01psbonusb.json | 20525 | 2025-07-22 15:39:36 |
| - | 2488396_MatoSpectoru_madmewmewbust2018naked01psbonusb.png | 492417 | 2025-07-22 15:39:36 |
| - | 2489573_MatoSpectoru_004karinbigheartpatreoncommfps2.0logo.json | 8957 | 2025-07-22 13:44:44 |
| - | 2489573_MatoSpectoru_004karinbigheartpatreoncommfps2.0logo.png | 457022 | 2025-07-22 13:44:44 |
| - | 2494216_MatoSpectoru_004captaincelaenopatreoncommfullcolorfps01.json | 13113 | 2025-07-22 12:36:44 |
| - | 2494216_MatoSpectoru_004captaincelaenopatreoncommfullcolorfps01.png | 801548 | 2025-07-22 12:36:44 |
| - | 2494218_MatoSpectoru_004captaincelaenopatreoncommfullcolorfps02cum.json | 13113 | 2025-07-22 12:36:44 |
| - | 2494218_MatoSpectoru_004captaincelaenopatreoncommfullcolorfps02cum.png | 820157 | 2025-07-22 12:36:44 |
| - | 2496951_MatoSpectoru_004octoberwinnerwendyokoopafpspatreonlogo.json | 10156 | 2025-07-22 11:50:42 |
| - | 2496951_MatoSpectoru_004octoberwinnerwendyokoopafpspatreonlogo.png | 777888 | 2025-07-22 11:50:42 |
| - | 2497901_MatoSpectoru_004afullcolornicolewattersoncommf001pslogolr.json | 14646 | 2025-07-22 11:33:35 |
| - | 2497901_MatoSpectoru_004afullcolornicolewattersoncommf001pslogolr.png | 524638 | 2025-07-22 11:33:35 |
| - | 2497903_MatoSpectoru_004bfullcolornicolewattersoncommf002pslogolr.json | 14646 | 2025-07-22 11:33:35 |
| - | 2497903_MatoSpectoru_004bfullcolornicolewattersoncommf002pslogolr.png | 555121 | 2025-07-22 11:33:35 |
| - | 2497904_MatoSpectoru_004cfullcolornicolewattersoncommf003pslogolr.json | 14646 | 2025-07-22 11:33:35 |
| - | 2497904_MatoSpectoru_004cfullcolornicolewattersoncommf003pslogolr.png | 542352 | 2025-07-22 11:33:35 |
| - | 2503238_MatoSpectoru_004takeshipandaocordofps3.0.json | 7404 | 2025-07-22 10:04:09 |
| - | 2503238_MatoSpectoru_004takeshipandaocordofps3.0.png | 433163 | 2025-07-22 10:04:09 |
| - | 2505312_MatoSpectoru_003takeshixleiyinflatcolorps.json | 11635 | 2025-07-22 09:27:30 |
| - | 2505312_MatoSpectoru_003takeshixleiyinflatcolorps.png | 386383 | 2025-07-22 09:27:30 |
| - | 2505313_MatoSpectoru_003takeshixleiyinflatcolorcumps.json | 11635 | 2025-07-22 09:27:30 |
| - | 2505313_MatoSpectoru_003takeshixleiyinflatcolorcumps.png | 391685 | 2025-07-22 09:27:30 |
| - | 2506529_MatoSpectoru_04aneekololf01psbpatreon.json | 12016 | 2025-07-22 09:07:35 |
| - | 2506529_MatoSpectoru_04aneekololf01psbpatreon.png | 856846 | 2025-07-22 09:07:35 |
| - | 2506530_MatoSpectoru_04aneekololf02psbpatreon.json | 12016 | 2025-07-22 09:07:36 |
| - | 2506530_MatoSpectoru_04aneekololf02psbpatreon.png | 865318 | 2025-07-22 09:07:36 |
| - | 2508754_MatoSpectoru_004asakana888888888birthday2018nobg.json | 7895 | 2025-07-22 08:32:45 |
| - | 2508754_MatoSpectoru_004asakana888888888birthday2018nobg.png | 396192 | 2025-07-22 08:32:45 |
| - | 2512839_MatoSpectoru_004amidnabustnovemberfemalefanartmonthlypolln_01patreonlogo.json | 13213 | 2025-07-22 07:30:52 |
| - | 2512839_MatoSpectoru_004amidnabustnovemberfemalefanartmonthlypolln_01patreonlogo.png | 940661 | 2025-07-22 07:30:52 |
| - | 2512840_MatoSpectoru_004cmidnabustnovemberfemalefanartmonthlypolln_03patreonlogob.json | 13213 | 2025-07-22 07:30:52 |
| - | 2512840_MatoSpectoru_004cmidnabustnovemberfemalefanartmonthlypolln_03patreonlogob.png | 426147 | 2025-07-22 07:30:52 |
| - | 2519035_MatoSpectoru_004midnadecemberpatreoncommfullcolorpsfretouchlrpatreonlogo.json | 9809 | 2025-07-22 05:59:06 |
| - | 2519035_MatoSpectoru_004midnadecemberpatreoncommfullcolorpsfretouchlrpatreonlogo.png | 766981 | 2025-07-22 05:59:06 |
| - | 2525682_MatoSpectoru_004strawberrypatreoncommfullcolorpspatreonlogo.json | 8887 | 2025-07-22 04:23:51 |
| - | 2525682_MatoSpectoru_004strawberrypatreoncommfullcolorpspatreonlogo.png | 585165 | 2025-07-22 04:23:51 |
| - | 2527242_MatoSpectoru_004apatreoncommmushidecembercropfpsfullcolorpatreonlogo.json | 14649 | 2025-07-22 04:01:02 |
| - | 2527242_MatoSpectoru_004apatreoncommmushidecembercropfpsfullcolorpatreonlogo.png | 835038 | 2025-07-22 04:01:02 |
| - | 2527247_MatoSpectoru_004bpatreoncommmushidecembercropfpsfullcolorcumpatreonlogo.json | 14649 | 2025-07-22 04:01:03 |
| - | 2527247_MatoSpectoru_004bpatreoncommmushidecembercropfpsfullcolorcumpatreonlogo.png | 849178 | 2025-07-22 04:01:03 |
| - | 2536043_MatoSpectoru_004aleiyincommfullcoloralps_01patreonlogo.json | 12180 | 2025-07-22 01:53:54 |
| - | 2536043_MatoSpectoru_004aleiyincommfullcoloralps_01patreonlogo.png | 427614 | 2025-07-22 01:53:54 |
| - | 2536045_MatoSpectoru_004aleiyincommfullcoloralps_02patreonlogo.json | 12180 | 2025-07-22 01:53:54 |
| - | 2536045_MatoSpectoru_004aleiyincommfullcoloralps_02patreonlogo.png | 500372 | 2025-07-22 01:53:54 |
| - | 2538699_MatoSpectoru_004twilightxnightlightblowjobfullcolorpspatreonlogolr.json | 9480 | 2025-07-22 01:12:29 |
| - | 2538699_MatoSpectoru_004twilightxnightlightblowjobfullcolorpspatreonlogolr.png | 894149 | 2025-07-22 01:12:29 |
| - | 2539825_MatoSpectoru_004akaorifumokoshifullcolorcommfullcolorglassespslrpatreonlogo.json | 12103 | 2025-07-22 00:53:47 |
| - | 2539825_MatoSpectoru_004akaorifumokoshifullcolorcommfullcolorglassespslrpatreonlogo.png | 742308 | 2025-07-22 00:53:47 |
| - | 2539827_MatoSpectoru_004akaorifumokoshifullcolorcommfullcolornoglassespslrpatreonlogo.json | 12103 | 2025-07-22 00:53:47 |
| - | 2539827_MatoSpectoru_004akaorifumokoshifullcolorcommfullcolornoglassespslrpatreonlogo.png | 734926 | 2025-07-22 00:53:47 |
| - | 2545478_MatoSpectoru_xmasoc2018fullcolorf2pslrtext.json | 10316 | 2025-07-21 23:23:52 |
| - | 2545478_MatoSpectoru_xmasoc2018fullcolorf2pslrtext.png | 1532281 | 2025-07-21 23:23:52 |
| - | 2563464_MatoSpectoru_004fullcolorgreninjapatreoncommfpsfullcolorlogopatreon.json | 8415 | 2025-07-21 18:15:07 |
| - | 2563464_MatoSpectoru_004fullcolorgreninjapatreoncommfpsfullcolorlogopatreon.png | 3169874 | 2025-07-21 18:15:07 |
| - | 2565812_MatoSpectoru_004a_1_fullcolornicolewattersonpatreomcomm01fpsnotextpatreonlogo.json | 14380 | 2025-07-21 17:36:57 |
| - | 2565812_MatoSpectoru_004a_1_fullcolornicolewattersonpatreomcomm01fpsnotextpatreonlogo.png | 427359 | 2025-07-21 17:36:57 |
| - | 2565813_MatoSpectoru_004a_2_fullcolornicolewattersonpatreomcomm02fpsnotextpatreonlogo.json | 14380 | 2025-07-21 17:36:57 |
| - | 2565813_MatoSpectoru_004a_2_fullcolornicolewattersonpatreomcomm02fpsnotextpatreonlogo.png | 658763 | 2025-07-21 17:36:57 |
| - | 2570516_MatoSpectoru_004fullcolorkangaskhanpatreoncommfpsf2logopatreon.json | 8879 | 2025-07-21 16:16:32 |
| - | 2570516_MatoSpectoru_004fullcolorkangaskhanpatreoncommfpsf2logopatreon.png | 662719 | 2025-07-21 16:16:32 |
| - | 2571759_MatoSpectoru_004aarttradekirliapokemonrunbasambatwitterfullcolorps.json | 16718 | 2025-07-21 15:37:05 |
| - | 2571759_MatoSpectoru_004aarttradekirliapokemonrunbasambatwitterfullcolorps.png | 537781 | 2025-07-21 15:37:05 |
| - | 2571760_MatoSpectoru_004barttradekirliapokemonrunbasambatwitterfullcolorpsoppai.json | 16718 | 2025-07-21 15:37:06 |
| - | 2571760_MatoSpectoru_004barttradekirliapokemonrunbasambatwitterfullcolorpsoppai.png | 547478 | 2025-07-21 15:37:06 |
| - | 2571761_MatoSpectoru_005aarttradekirliashinypokemonrunbasambatwitterfullcolorps.json | 16718 | 2025-07-21 15:37:06 |
| - | 2571761_MatoSpectoru_005aarttradekirliashinypokemonrunbasambatwitterfullcolorps.png | 518720 | 2025-07-21 15:37:06 |
| - | 2571762_MatoSpectoru_005barttradekirliashinypokemonrunbasambatwitterfullcolorpsoppai.json | 16718 | 2025-07-21 15:37:06 |
| - | 2571762_MatoSpectoru_005barttradekirliashinypokemonrunbasambatwitterfullcolorpsoppai.png | 536333 | 2025-07-21 15:37:06 |
| - | 2579538_MatoSpectoru_004afullcolorbunnierabbotpatreoncommfpspatreonlogo.json | 9372 | 2025-07-21 13:38:20 |
| - | 2579538_MatoSpectoru_004afullcolorbunnierabbotpatreoncommfpspatreonlogo.png | 1333290 | 2025-07-21 13:38:20 |
| - | 2580532_MatoSpectoru_004fullcolorvampiarttradefps.json | 8895 | 2025-07-21 13:19:38 |
| - | 2580532_MatoSpectoru_004fullcolorvampiarttradefps.png | 649537 | 2025-07-21 13:19:38 |
| - | 2604202_MatoSpectoru_04petraisbackarthotkekearttradepsf2.json | 11696 | 2025-07-21 06:46:20 |
| - | 2604202_MatoSpectoru_04petraisbackarthotkekearttradepsf2.png | 736887 | 2025-07-21 06:46:20 |
| - | 2604203_MatoSpectoru_05petraisbackarthotkekearttradepsf2cum.json | 11696 | 2025-07-21 06:46:21 |
| - | 2604203_MatoSpectoru_05petraisbackarthotkekearttradepsf2cum.png | 771426 | 2025-07-21 06:46:21 |
| - | 2604217_MatoSpectoru_004ahoraedeerlingyogaflatcolorcommfullcolor02pslogolr.json | 11540 | 2025-07-21 06:46:09 |
| - | 2604217_MatoSpectoru_004ahoraedeerlingyogaflatcolorcommfullcolor02pslogolr.png | 451476 | 2025-07-21 06:46:09 |
| - | 2604220_MatoSpectoru_004bhoraedeerlingyogaflatcolorcommfullcolor01pslogolr.json | 11540 | 2025-07-21 06:46:09 |
| - | 2604220_MatoSpectoru_004bhoraedeerlingyogaflatcolorcommfullcolor01pslogolr.png | 445814 | 2025-07-21 06:46:09 |
| - | 2606532_MatoSpectoru_004bmu-shipatreoncommfullcolorps02logo.json | 9735 | 2025-07-21 06:10:33 |
| - | 2606532_MatoSpectoru_004bmu-shipatreoncommfullcolorps02logo.png | 526608 | 2025-07-21 06:10:33 |
| - | 2608922_MatoSpectoru_004bgardevoirpatreoncommfullcolorfpsglasseslogo.json | 10744 | 2025-07-21 05:31:25 |
| - | 2608922_MatoSpectoru_004bgardevoirpatreoncommfullcolorfpsglasseslogo.png | 712591 | 2025-07-21 05:31:25 |
| - | 2608923_MatoSpectoru_004agardevoirpatreoncommfullcolorfpslogo.json | 10744 | 2025-07-21 05:31:25 |
| - | 2608923_MatoSpectoru_004agardevoirpatreoncommfullcolorfpslogo.png | 710368 | 2025-07-21 05:31:25 |
| - | 2610041_MatoSpectoru_004aadeliabirthday2019chundraw4235fullcolorfps01b.json | 8488 | 2025-07-21 05:11:22 |
| - | 2610041_MatoSpectoru_004aadeliabirthday2019chundraw4235fullcolorfps01b.png | 784344 | 2025-07-21 05:11:22 |
| - | 2612064_MatoSpectoru_004branamonhbagfullcolorps02.json | 8638 | 2025-07-21 04:40:57 |
| - | 2612064_MatoSpectoru_004branamonhbagfullcolorps02.png | 1007794 | 2025-07-21 04:40:57 |
| - | 2614797_MatoSpectoru_004afullcolornicolewattersonsjimbobbyishcommps01logo.json | 10247 | 2025-07-21 03:55:56 |
| - | 2614797_MatoSpectoru_004afullcolornicolewattersonsjimbobbyishcommps01logo.png | 448508 | 2025-07-21 03:55:56 |
| - | 2614839_MatoSpectoru_004a-3ponysfullcolorps.json | 11878 | 2025-07-21 03:55:08 |
| - | 2614839_MatoSpectoru_004a-3ponysfullcolorps.png | 909936 | 2025-07-21 03:55:08 |
| - | 2614840_MatoSpectoru_004b-3ponysfullcolorpscum.json | 11878 | 2025-07-21 03:55:09 |
| - | 2614840_MatoSpectoru_004b-3ponysfullcolorpscum.png | 1069420 | 2025-07-21 03:55:09 |
| - | 2625304_MatoSpectoru_004aprimarinatentaclespatreoncommfebruaryfullcolorpsblogo.json | 13205 | 2025-07-21 01:14:18 |
| - | 2625304_MatoSpectoru_004aprimarinatentaclespatreoncommfebruaryfullcolorpsblogo.png | 1019373 | 2025-07-21 01:14:18 |
| - | 2625306_MatoSpectoru_004bprimarinatentaclespatreoncommfebruaryfullcolorpsbmilklogo.json | 13205 | 2025-07-21 01:14:18 |
| - | 2625306_MatoSpectoru_004bprimarinatentaclespatreoncommfebruaryfullcolorpsbmilklogo.png | 1035126 | 2025-07-21 01:14:18 |
| - | 2626372_MatoSpectoru_004giratinapatreoncommfebruaryfullcolorfps2.0logo.json | 8677 | 2025-07-21 00:55:30 |
| - | 2626372_MatoSpectoru_004giratinapatreoncommfebruaryfullcolorfps2.0logo.png | 659719 | 2025-07-21 00:55:30 |
| - | 2629710_MatoSpectoru_004gloriamadagascarpatreoncommcrop02fullcolorpslogoxlr.json | 8856 | 2025-07-20 23:58:15 |
| - | 2629710_MatoSpectoru_004gloriamadagascarpatreoncommcrop02fullcolorpslogoxlr.png | 489969 | 2025-07-20 23:58:15 |
| - | 2630792_MatoSpectoru_004acometpatreoncommfullcolorpslogo.json | 11756 | 2025-07-20 23:37:03 |
| - | 2630792_MatoSpectoru_004acometpatreoncommfullcolorpslogo.png | 684468 | 2025-07-20 23:37:03 |
| - | 2630793_MatoSpectoru_004bcometpatreoncommfullcolorpscumlogo.json | 11756 | 2025-07-20 23:37:03 |
| - | 2630793_MatoSpectoru_004bcometpatreoncommfullcolorpscumlogo.png | 697393 | 2025-07-20 23:37:03 |
| - | 2631857_MatoSpectoru_004btorielpatreoncommfebruarycropfullcolorpsa2fcropbnocum1-2logo.json | 9431 | 2025-07-20 23:17:40 |
| - | 2631857_MatoSpectoru_004btorielpatreoncommfebruarycropfullcolorpsa2fcropbnocum1-2logo.png | 748890 | 2025-07-20 23:17:40 |
| - | 2633164_MatoSpectoru_004amewtwo-mfp8february2019mewtwofullcolorpslogo.json | 18742 | 2025-07-20 22:55:32 |
| - | 2633164_MatoSpectoru_004amewtwo-mfp8february2019mewtwofullcolorpslogo.png | 482222 | 2025-07-20 22:55:32 |
| - | 2633169_MatoSpectoru_004bmewtwo-mfp8february2019shinymewtwofullcolorpslogo.json | 18742 | 2025-07-20 22:55:33 |
| - | 2633169_MatoSpectoru_004bmewtwo-mfp8february2019shinymewtwofullcolorpslogo.png | 471719 | 2025-07-20 22:55:33 |
| - | 2633173_MatoSpectoru_004cmewtwo-mfp8february2019mewmewtwofullcolorpslogo.json | 18742 | 2025-07-20 22:55:33 |
| - | 2633173_MatoSpectoru_004cmewtwo-mfp8february2019mewmewtwofullcolorpslogo.png | 454715 | 2025-07-20 22:55:33 |
| - | 2633174_MatoSpectoru_004dmewtwo-mfp8february2019shadowmewtwofullcolorps2.0logo.json | 18742 | 2025-07-20 22:55:34 |
| - | 2633174_MatoSpectoru_004dmewtwo-mfp8february2019shadowmewtwofullcolorps2.0logo.png | 479389 | 2025-07-20 22:55:34 |
| - | 2633181_MatoSpectoru_mewtwo_transition_6.5_lr.gif | 9065050 | 2025-07-20 22:55:35 |
| - | 2633181_MatoSpectoru_mewtwo_transition_6.5_lr.json | 18742 | 2025-07-20 22:55:35 |
| - | 2645495_MatoSpectoru_004hydreigonpatreoncommfullcolorfpsblogo.json | 8551 | 2025-07-20 19:31:19 |
| - | 2645495_MatoSpectoru_004hydreigonpatreoncommfullcolorfpsblogo.png | 1037730 | 2025-07-20 19:31:19 |
| - | 2646552_MatoSpectoru_004veronaocpatreoncommfullcolorfpsfblogo.json | 7924 | 2025-07-20 19:11:57 |
| - | 2646552_MatoSpectoru_004veronaocpatreoncommfullcolorfpsfblogo.png | 770737 | 2025-07-20 19:11:57 |
| - | 2649688_MatoSpectoru_004afrapterxkarinbigheartpatreoncommfullcolorpsalogo.json | 12909 | 2025-07-20 14:44:34 |
| - | 2649688_MatoSpectoru_004afrapterxkarinbigheartpatreoncommfullcolorpsalogo.png | 667560 | 2025-07-20 14:44:34 |
| - | 2649689_MatoSpectoru_004bfrapterxkarinbigheartpatreoncommfullcolorpsblogo.json | 12909 | 2025-07-20 14:44:35 |
| - | 2649689_MatoSpectoru_004bfrapterxkarinbigheartpatreoncommfullcolorpsblogo.png | 675265 | 2025-07-20 14:44:35 |
| - | 2656304_MatoSpectoru_004anilasternxhumanpatreoncommfullcolor01pslogo.json | 17003 | 2025-07-20 12:29:55 |
| - | 2656304_MatoSpectoru_004anilasternxhumanpatreoncommfullcolor01pslogo.png | 828126 | 2025-07-20 12:29:55 |
| - | 2656357_MatoSpectoru_004bnilasternxhumanpatreoncommfullcolor01pscumlogo.json | 17003 | 2025-07-20 12:29:56 |
| - | 2656357_MatoSpectoru_004bnilasternxhumanpatreoncommfullcolor01pscumlogo.png | 925716 | 2025-07-20 12:29:56 |
| - | 2656360_MatoSpectoru_004cnilasternxhumanpatreoncommfullcolor02psblogo.json | 17003 | 2025-07-20 12:29:56 |
| - | 2656360_MatoSpectoru_004cnilasternxhumanpatreoncommfullcolor02psblogo.png | 935778 | 2025-07-20 12:29:56 |
| - | 2656364_MatoSpectoru_004dnilasternxhumanpatreoncommfullcolor02psbcumlogo.json | 17003 | 2025-07-20 12:29:56 |
| - | 2656364_MatoSpectoru_004dnilasternxhumanpatreoncommfullcolor02psbcumlogo.png | 939251 | 2025-07-20 12:29:56 |
| - | 2661159_MatoSpectoru_004ablazexrougeslutmaniaplusmatospectorufpsnetf.json | 13565 | 2025-07-20 10:50:25 |
| - | 2661159_MatoSpectoru_004ablazexrougeslutmaniaplusmatospectorufpsnetf.png | 1180634 | 2025-07-20 10:50:25 |
| - | 2661160_MatoSpectoru_004bblazexrougeslutmaniaplusmatospectorufps.json | 13565 | 2025-07-20 10:50:27 |
| - | 2661160_MatoSpectoru_004bblazexrougeslutmaniaplusmatospectorufps.png | 782895 | 2025-07-20 10:50:27 |
| - | 2670254_MatoSpectoru_004afrancineyagamixjasonyagamicommfullcolorpsalogo.json | 14079 | 2025-07-20 07:56:47 |
| - | 2670254_MatoSpectoru_004afrancineyagamixjasonyagamicommfullcolorpsalogo.png | 682928 | 2025-07-20 07:56:47 |
| - | 2670255_MatoSpectoru_004bfrancineyagamixjasonyagamicommfullcolorpsblogo.json | 14079 | 2025-07-20 07:56:47 |
| - | 2670255_MatoSpectoru_004bfrancineyagamixjasonyagamicommfullcolorpsblogo.png | 766248 | 2025-07-20 07:56:47 |
| - | 2670257_MatoSpectoru_004cfrancineyagamixjasonyagamicommfullcolorpsclogo.json | 14079 | 2025-07-20 07:56:48 |
| - | 2670257_MatoSpectoru_004cfrancineyagamixjasonyagamicommfullcolorpsclogo.png | 868562 | 2025-07-20 07:56:48 |
| - | 2671384_MatoSpectoru_004alancelittleoccommfullcolorpsalogo.json | 14098 | 2025-07-20 07:30:14 |
| - | 2671384_MatoSpectoru_004alancelittleoccommfullcolorpsalogo.png | 508702 | 2025-07-20 07:30:14 |
| - | 2671386_MatoSpectoru_004blancelittleoccommfullcolorpsblogo.json | 14098 | 2025-07-20 07:30:14 |
| - | 2671386_MatoSpectoru_004blancelittleoccommfullcolorpsblogo.png | 629458 | 2025-07-20 07:30:14 |
| - | 2671387_MatoSpectoru_004blancelittleoccommfullcolorpsa-blogo.json | 14098 | 2025-07-20 07:30:15 |
| - | 2671387_MatoSpectoru_004blancelittleoccommfullcolorpsa-blogo.png | 1106208 | 2025-07-20 07:30:15 |
| - | 2672511_MatoSpectoru_005bcalypsotheprimarinacommfullcolorfpsbtextlogo.json | 15032 | 2025-07-20 07:04:19 |
| - | 2672511_MatoSpectoru_005bcalypsotheprimarinacommfullcolorfpsbtextlogo.png | 824912 | 2025-07-20 07:04:19 |
| - | 2672512_MatoSpectoru_005bcalypsotheprimarinacommfullcolorfpsbcumtextlogo.json | 15032 | 2025-07-20 07:04:22 |
| - | 2672512_MatoSpectoru_005bcalypsotheprimarinacommfullcolorfpsbcumtextlogo.png | 840207 | 2025-07-20 07:04:22 |
| - | 2673544_MatoSpectoru_004atailsxrougesmellslikerougecommpijamafpsb.json | 12636 | 2025-07-20 06:44:03 |
| - | 2673544_MatoSpectoru_004atailsxrougesmellslikerougecommpijamafpsb.png | 834293 | 2025-07-20 06:44:03 |
| - | 2673545_MatoSpectoru_004btailsxrougesmellslikerougecommnudefpsb.json | 12636 | 2025-07-20 06:44:03 |
| - | 2673545_MatoSpectoru_004btailsxrougesmellslikerougecommnudefpsb.png | 826273 | 2025-07-20 06:44:03 |
| - | 2674743_MatoSpectoru_004bsonikkomaidpatreoncommfullcolorfpsheartlogo.json | 9502 | 2025-07-20 06:24:42 |
| - | 2674743_MatoSpectoru_004bsonikkomaidpatreoncommfullcolorfpsheartlogo.png | 840128 | 2025-07-20 06:24:42 |
| - | 2677262_MatoSpectoru_005aalicesheepstarcollabfutachocolate.json | 13098 | 2025-07-20 05:44:22 |
| - | 2677262_MatoSpectoru_005aalicesheepstarcollabfutachocolate.png | 1465164 | 2025-07-20 05:44:22 |
| - | 2677264_MatoSpectoru_005balicesheepstarcollabfutanude.json | 13098 | 2025-07-20 05:44:22 |
| - | 2677264_MatoSpectoru_005balicesheepstarcollabfutanude.png | 1459597 | 2025-07-20 05:44:22 |
| - | 2678487_MatoSpectoru_004ajasperstevenuniversecommfullcolor01pslogo.json | 11884 | 2025-07-20 05:24:21 |
| - | 2678487_MatoSpectoru_004ajasperstevenuniversecommfullcolor01pslogo.png | 779776 | 2025-07-20 05:24:21 |
| - | 2678489_MatoSpectoru_004bjasperstevenuniversecommfullcolor02psblogo.json | 11884 | 2025-07-20 05:24:21 |
| - | 2678489_MatoSpectoru_004bjasperstevenuniversecommfullcolor02psblogo.png | 874201 | 2025-07-20 05:24:21 |
| - | 2688019_MatoSpectoru_004linaocpatreoncommfullcolorfpslogo.json | 8573 | 2025-07-20 02:40:20 |
| - | 2688019_MatoSpectoru_004linaocpatreoncommfullcolorfpslogo.png | 817828 | 2025-07-20 02:40:20 |
| - | 2689197_MatoSpectoru_004alugiafemalepatreoncommfullcolorfpslogo.json | 12916 | 2025-07-20 02:20:17 |
| - | 2689197_MatoSpectoru_004alugiafemalepatreoncommfullcolorfpslogo.png | 507175 | 2025-07-20 02:20:17 |
| - | 2689199_MatoSpectoru_004blugiafemalepatreoncommfullcolorfpsmilklogo.json | 12916 | 2025-07-20 02:20:18 |
| - | 2689199_MatoSpectoru_004blugiafemalepatreoncommfullcolorfpsmilklogo.png | 514105 | 2025-07-20 02:20:18 |
| - | 2690451_MatoSpectoru_004bmegaeraocfullcolorcommfps2.0blogo.json | 8375 | 2025-07-20 02:04:12 |
| - | 2690451_MatoSpectoru_004bmegaeraocfullcolorcommfps2.0blogo.png | 662605 | 2025-07-20 02:04:12 |
| - | 2691411_MatoSpectoru_004anilasternanalpatreoncommfullcolorfpslogo.json | 8655 | 2025-07-20 01:45:39 |
| - | 2691411_MatoSpectoru_004anilasternanalpatreoncommfullcolorfpslogo.png | 510143 | 2025-07-20 01:45:39 |
| - | 2699070_MatoSpectoru_004anicolewattersongooddaycommfullcolor001apslrlogo.json | 23578 | 2025-07-19 23:08:31 |
| - | 2699070_MatoSpectoru_004anicolewattersongooddaycommfullcolor001apslrlogo.png | 576675 | 2025-07-19 23:08:31 |
| - | 2699071_MatoSpectoru_004bnicolewattersongooddaycommfullcolor001bpslrlogo.json | 23578 | 2025-07-19 23:08:31 |
| - | 2699071_MatoSpectoru_004bnicolewattersongooddaycommfullcolor001bpslrlogo.png | 590110 | 2025-07-19 23:08:31 |
| - | 2699072_MatoSpectoru_004cnicolewattersongooddaycommfullcolor002pslrlogo.json | 23578 | 2025-07-19 23:08:32 |
| - | 2699072_MatoSpectoru_004cnicolewattersongooddaycommfullcolor002pslrlogo.png | 565139 | 2025-07-19 23:08:32 |
| - | 2699073_MatoSpectoru_004dnicolewattersongooddaycommfullcolor003apslrlogo.json | 23578 | 2025-07-19 23:08:32 |
| - | 2699073_MatoSpectoru_004dnicolewattersongooddaycommfullcolor003apslrlogo.png | 586239 | 2025-07-19 23:08:32 |
| - | 2699074_MatoSpectoru_005bnicolewattersongooddaycommfullcolor001bpscumlrlogo.json | 23578 | 2025-07-19 23:08:32 |
| - | 2699074_MatoSpectoru_005bnicolewattersongooddaycommfullcolor001bpscumlrlogo.png | 597990 | 2025-07-19 23:08:32 |
| - | 2699075_MatoSpectoru_005cnicolewattersongooddaycommfullcolor002pscumlogo.json | 23578 | 2025-07-19 23:08:32 |
| - | 2699075_MatoSpectoru_005cnicolewattersongooddaycommfullcolor002pscumlogo.png | 569743 | 2025-07-19 23:08:32 |
| - | 2699076_MatoSpectoru_005enicolewattersongooddaycommfullcolor003bpscumlrlogo.json | 23578 | 2025-07-19 23:08:32 |
| - | 2699076_MatoSpectoru_005enicolewattersongooddaycommfullcolor003bpscumlrlogo.png | 618870 | 2025-07-19 23:08:32 |
| - | 2708426_MatoSpectoru_004bmichelledelcattymilfcommfullcolorf02flogo.json | 11775 | 2025-07-19 17:43:19 |
| - | 2708426_MatoSpectoru_004bmichelledelcattymilfcommfullcolorf02flogo.png | 548107 | 2025-07-19 17:43:19 |
| - | 2708428_MatoSpectoru_004amichelledelcattymilfcommfullcolorf01flogo.json | 11775 | 2025-07-19 17:43:20 |
| - | 2708428_MatoSpectoru_004amichelledelcattymilfcommfullcolorf01flogo.png | 566627 | 2025-07-19 17:43:20 |
| - | 2708991_MatoSpectoru_004aloymiyazakixhui-mincommfullcolorfps.json | 11791 | 2025-07-19 17:33:19 |
| - | 2708991_MatoSpectoru_004aloymiyazakixhui-mincommfullcolorfps.png | 676227 | 2025-07-19 17:33:19 |
| - | 2708993_MatoSpectoru_004bloymiyazakixhui-mincommfullcolorfpscum.json | 11791 | 2025-07-19 17:33:19 |
| - | 2708993_MatoSpectoru_004bloymiyazakixhui-mincommfullcolorfpscum.png | 765470 | 2025-07-19 17:33:19 |
| - | 2713903_MatoSpectoru_003anianidaviscommflatcolorpsa.json | 11296 | 2025-07-19 15:42:16 |
| - | 2713903_MatoSpectoru_003anianidaviscommflatcolorpsa.png | 448521 | 2025-07-19 15:42:16 |
| - | 2713904_MatoSpectoru_003bnianidaviscommflatcolorpsb.json | 11296 | 2025-07-19 15:42:17 |
| - | 2713904_MatoSpectoru_003bnianidaviscommflatcolorpsb.png | 549990 | 2025-07-19 15:42:17 |
| - | 2718465_MatoSpectoru_004ludovicaocpatreoncommfullcolorpsflogo.json | 7751 | 2025-07-19 14:24:30 |
| - | 2718465_MatoSpectoru_004ludovicaocpatreoncommfullcolorpsflogo.png | 913936 | 2025-07-19 14:24:30 |
| - | 2719712_MatoSpectoru_004aalicesheepstarpatreoncommfullcolorfpsalogo.json | 12174 | 2025-07-19 14:00:04 |
| - | 2719712_MatoSpectoru_004aalicesheepstarpatreoncommfullcolorfpsalogo.png | 656288 | 2025-07-19 14:00:04 |
| - | 2719713_MatoSpectoru_004balicesheepstarpatreoncommfullcolorfpsblogo.json | 12174 | 2025-07-19 14:00:04 |
| - | 2719713_MatoSpectoru_004balicesheepstarpatreoncommfullcolorfpsblogo.png | 678115 | 2025-07-19 14:00:04 |
| - | 2737921_MatoSpectoru_004afrapterxmushipatreoncommfullcolorpsalogo.json | 14340 | 2025-07-19 09:52:32 |
| - | 2737921_MatoSpectoru_004afrapterxmushipatreoncommfullcolorpsalogo.png | 593822 | 2025-07-19 09:52:32 |
| - | 2737922_MatoSpectoru_004bfrapterxmushipatreoncommfullcolorpsacumlogo.json | 14340 | 2025-07-19 09:52:32 |
| - | 2737922_MatoSpectoru_004bfrapterxmushipatreoncommfullcolorpsacumlogo.png | 605587 | 2025-07-19 09:52:32 |
| - | 2738859_MatoSpectoru_004leslywolfessocpatreoncommfullcolorfpslogo.json | 8001 | 2025-07-19 09:40:16 |
| - | 2738859_MatoSpectoru_004leslywolfessocpatreoncommfullcolorfpslogo.png | 690314 | 2025-07-19 09:40:16 |
| - | 2738864_MatoSpectoru_004asashaocpatreoncommfullcolorfpsfbonuslogo.json | 11586 | 2025-07-19 09:40:13 |
| - | 2738864_MatoSpectoru_004asashaocpatreoncommfullcolorfpsfbonuslogo.png | 630249 | 2025-07-19 09:40:13 |
| - | 2738866_MatoSpectoru_004bsashaocpatreoncommfullcolorfpsfcum.json | 11586 | 2025-07-19 09:40:13 |
| - | 2738866_MatoSpectoru_004bsashaocpatreoncommfullcolorfpsfcum.png | 738065 | 2025-07-19 09:40:13 |
| - | 2738876_MatoSpectoru_004aminamongoosepatreoncommfullcolor_01logob.json | 9071 | 2025-07-19 09:40:04 |
| - | 2738876_MatoSpectoru_004aminamongoosepatreoncommfullcolor_01logob.png | 1038874 | 2025-07-19 09:40:04 |
| - | 2738961_MatoSpectoru_004asonikkocowmilkpatreoncommfullcolorfpslogo.json | 13309 | 2025-07-19 09:39:17 |
| - | 2738961_MatoSpectoru_004asonikkocowmilkpatreoncommfullcolorfpslogo.png | 894367 | 2025-07-19 09:39:17 |
| - | 2738962_MatoSpectoru_004bsonikkocowmilkpatreoncommfullcolorfpsmilklogo.json | 13309 | 2025-07-19 09:39:18 |
| - | 2738962_MatoSpectoru_004bsonikkocowmilkpatreoncommfullcolorfpsmilklogo.png | 982366 | 2025-07-19 09:39:18 |
| - | 2740793_MatoSpectoru_004asalazzlepatreoncommfullcolorfpslogo.json | 12305 | 2025-07-19 09:18:59 |
| - | 2740793_MatoSpectoru_004asalazzlepatreoncommfullcolorfpslogo.png | 997261 | 2025-07-19 09:18:59 |
| - | 2740795_MatoSpectoru_004bsalazzlepatreoncommfullcolorfpsshinylogo.json | 12305 | 2025-07-19 09:18:59 |
| - | 2740795_MatoSpectoru_004bsalazzlepatreoncommfullcolorfpsshinylogo.png | 1075381 | 2025-07-19 09:18:59 |
| - | 2740919_MatoSpectoru_006arougethebatbustmfp11may_05logob.json | 16283 | 2025-07-19 09:17:36 |
| - | 2740919_MatoSpectoru_006arougethebatbustmfp11may_05logob.png | 644222 | 2025-07-19 09:17:36 |
| - | 2740921_MatoSpectoru_006brougethebatbustmfp11may_06logo.json | 16283 | 2025-07-19 09:17:37 |
| - | 2740921_MatoSpectoru_006brougethebatbustmfp11may_06logo.png | 701732 | 2025-07-19 09:17:37 |
| - | 2740922_MatoSpectoru_010brougethebatbustmfp11may_16bonus.json | 16283 | 2025-07-19 09:17:37 |
| - | 2740922_MatoSpectoru_010brougethebatbustmfp11may_16bonus.png | 760301 | 2025-07-19 09:17:37 |
| - | 2740924_MatoSpectoru_006crougethebatbustmfp11may_07logo.json | 16283 | 2025-07-19 09:17:38 |
| - | 2740924_MatoSpectoru_006crougethebatbustmfp11may_07logo.png | 685859 | 2025-07-19 09:17:38 |
| - | 2741866_MatoSpectoru_004bmu-shixkarvaokadacommfullcolorfpsfblogo.json | 10943 | 2025-07-19 09:06:17 |
| - | 2741866_MatoSpectoru_004bmu-shixkarvaokadacommfullcolorfpsfblogo.png | 634253 | 2025-07-19 09:06:17 |
| - | 2744119_MatoSpectoru_commissions2019hriblr.json | 22330 | 2025-07-19 08:43:20 |
| - | 2744119_MatoSpectoru_commissions2019hriblr.png | 1588843 | 2025-07-19 08:43:20 |
| - | 2744120_MatoSpectoru_commissions2019hribpart001.json | 22330 | 2025-07-19 08:43:22 |
| - | 2744120_MatoSpectoru_commissions2019hribpart001.png | 5383457 | 2025-07-19 08:43:22 |
| - | 2744121_MatoSpectoru_commissions2019hribpart002.json | 22330 | 2025-07-19 08:43:23 |
| - | 2744121_MatoSpectoru_commissions2019hribpart002.png | 1626284 | 2025-07-19 08:43:23 |
| - | 2744123_MatoSpectoru_commissions2019hribpart003.json | 22330 | 2025-07-19 08:43:24 |
| - | 2744123_MatoSpectoru_commissions2019hribpart003.png | 936233 | 2025-07-19 08:43:24 |
| - | 2746876_MatoSpectoru_001beiraweavilecommsketch001packlogo.json | 8816 | 2025-07-19 08:12:41 |
| - | 2746876_MatoSpectoru_001beiraweavilecommsketch001packlogo.png | 242662 | 2025-07-19 08:12:41 |
| - | 2757094_MatoSpectoru_004cvivia_oc_comm_fullcolor_psb_logo.json | 11299 | 2025-07-19 06:28:24 |
| - | 2757094_MatoSpectoru_004cvivia_oc_comm_fullcolor_psb_logo.png | 720411 | 2025-07-19 06:28:24 |
| - | 2757104_MatoSpectoru_004avivia_oc_comm_fullcolor_psa_logo.json | 11299 | 2025-07-19 06:28:24 |
| - | 2757104_MatoSpectoru_004avivia_oc_comm_fullcolor_psa_logo.png | 650230 | 2025-07-19 06:28:24 |
| - | 2758117_MatoSpectoru_004adragonite_patreoncomm_fullcolor_f_apslogo.json | 16885 | 2025-07-19 06:16:14 |
| - | 2758117_MatoSpectoru_004adragonite_patreoncomm_fullcolor_f_apslogo.png | 1004940 | 2025-07-19 06:16:14 |
| - | 2758119_MatoSpectoru_004bdragonite_patreoncomm_fullcolor_f_apscumlogo.json | 16885 | 2025-07-19 06:16:14 |
| - | 2758119_MatoSpectoru_004bdragonite_patreoncomm_fullcolor_f_apscumlogo.png | 791167 | 2025-07-19 06:16:14 |
| - | 2758124_MatoSpectoru_005adragonite_patreoncomm_fullcolor_f_bpslogo.json | 16885 | 2025-07-19 06:16:14 |
| - | 2758124_MatoSpectoru_005adragonite_patreoncomm_fullcolor_f_bpslogo.png | 698995 | 2025-07-19 06:16:14 |
| - | 2758125_MatoSpectoru_005bdragonite_patreoncomm_fullcolor_f_bpscumlogo.json | 16885 | 2025-07-19 06:16:14 |
| - | 2758125_MatoSpectoru_005bdragonite_patreoncomm_fullcolor_f_bpscumlogo.png | 714215 | 2025-07-19 06:16:14 |
| - | 2759182_MatoSpectoru_004anila_oc_x_frapter_oc_patreoncomm_fullcolor_fpsalogo.json | 13010 | 2025-07-19 06:05:43 |
| - | 2759182_MatoSpectoru_004anila_oc_x_frapter_oc_patreoncomm_fullcolor_fpsalogo.png | 932482 | 2025-07-19 06:05:43 |
| - | 2759185_MatoSpectoru_004bnila_oc_x_frapter_oc_patreoncomm_fullcolor_fpscumalogo.json | 13010 | 2025-07-19 06:05:44 |
| - | 2759185_MatoSpectoru_004bnila_oc_x_frapter_oc_patreoncomm_fullcolor_fpscumalogo.png | 776226 | 2025-07-19 06:05:44 |
| - | 2760485_MatoSpectoru_004ealice_sheepstar_oc_x_frapter_oc_patreoncomm_fullcolor_fpswet_logo.json | 13822 | 2025-07-19 05:50:40 |
| - | 2760485_MatoSpectoru_004ealice_sheepstar_oc_x_frapter_oc_patreoncomm_fullcolor_fpswet_logo.png | 727191 | 2025-07-19 05:50:40 |
| - | 2760487_MatoSpectoru_004falice_sheepstar_oc_x_frapter_oc_patreoncomm_fullcolor_fpswetcum_logo.json | 13822 | 2025-07-19 05:50:41 |
| - | 2760487_MatoSpectoru_004falice_sheepstar_oc_x_frapter_oc_patreoncomm_fullcolor_fpswetcum_logo.png | 762763 | 2025-07-19 05:50:41 |
| - | 2761328_MatoSpectoru_004alei-yin_oc_patreoncomm_fullcolor_fps_logo.json | 12768 | 2025-07-19 05:39:03 |
| - | 2761328_MatoSpectoru_004alei-yin_oc_patreoncomm_fullcolor_fps_logo.png | 762050 | 2025-07-19 05:39:03 |
| - | 2761333_MatoSpectoru_004blei-yin_oc_patreoncomm_fullcolor_fpscum_logo.json | 12768 | 2025-07-19 05:39:03 |
| - | 2761333_MatoSpectoru_004blei-yin_oc_patreoncomm_fullcolor_fpscum_logo.png | 783962 | 2025-07-19 05:39:03 |
| - | 2763857_MatoSpectoru_004acoco_bandicoot_cocojam4_01apslogo.json | 16224 | 2025-07-19 05:12:17 |
| - | 2763857_MatoSpectoru_004acoco_bandicoot_cocojam4_01apslogo.png | 1111599 | 2025-07-19 05:12:17 |
| - | 2763862_MatoSpectoru_004bcoco_bandicoot_cocojam4_01apscumlogo.json | 16224 | 2025-07-19 05:12:17 |
| - | 2763862_MatoSpectoru_004bcoco_bandicoot_cocojam4_01apscumlogo.png | 883661 | 2025-07-19 05:12:17 |
| - | 2763869_MatoSpectoru_005acoco_bandicoot_cocojam4_01bpslogo.json | 16224 | 2025-07-19 05:12:18 |
| - | 2763869_MatoSpectoru_005acoco_bandicoot_cocojam4_01bpslogo.png | 1107408 | 2025-07-19 05:12:18 |
| - | 2763887_MatoSpectoru_005bcoco_bandicoot_cocojam4_01bpscumlogo.json | 16224 | 2025-07-19 05:12:18 |
| - | 2763887_MatoSpectoru_005bcoco_bandicoot_cocojam4_01bpscumlogo.png | 887907 | 2025-07-19 05:12:18 |
| - | 2778118_MatoSpectoru_004alina_oc_comm_fullcolor_fpsf2_logo.json | 12087 | 2025-07-19 02:32:01 |
| - | 2778118_MatoSpectoru_004alina_oc_comm_fullcolor_fpsf2_logo.png | 600371 | 2025-07-19 02:32:01 |
| - | 2778123_MatoSpectoru_004blina_oc_comm_fullcolor_fpsf2_cum_logo.json | 12087 | 2025-07-19 02:32:02 |
| - | 2778123_MatoSpectoru_004blina_oc_comm_fullcolor_fpsf2_cum_logo.png | 681343 | 2025-07-19 02:32:02 |
| - | 2780363_MatoSpectoru_005abaybay_gardevoir_comm_fullcolor_ps02a_logo.json | 15998 | 2025-07-19 02:08:05 |
| - | 2780363_MatoSpectoru_005abaybay_gardevoir_comm_fullcolor_ps02a_logo.png | 630197 | 2025-07-19 02:08:05 |
| - | 2780365_MatoSpectoru_005bbaybay_gardevoir_comm_fullcolor_ps02b_logo.json | 15998 | 2025-07-19 02:08:05 |
| - | 2780365_MatoSpectoru_005bbaybay_gardevoir_comm_fullcolor_ps02b_logo.png | 734362 | 2025-07-19 02:08:05 |
| - | 2780368_MatoSpectoru_006abaybay_gardevoir_comm_fullcolor_ps01a_logo.json | 15998 | 2025-07-19 02:08:05 |
| - | 2780368_MatoSpectoru_006abaybay_gardevoir_comm_fullcolor_ps01a_logo.png | 629738 | 2025-07-19 02:08:05 |
| - | 2780372_MatoSpectoru_006bbaybay_gardevoir_comm_fullcolor_ps01b_logo.json | 15998 | 2025-07-19 02:08:06 |
| - | 2780372_MatoSpectoru_006bbaybay_gardevoir_comm_fullcolor_ps01b_logo.png | 729897 | 2025-07-19 02:08:06 |
| - | 2786175_MatoSpectoru_004akona_oc_comm_fullcolor_fpsa1_logo.json | 16864 | 2025-07-19 01:08:02 |
| - | 2786175_MatoSpectoru_004akona_oc_comm_fullcolor_fpsa1_logo.png | 867184 | 2025-07-19 01:08:02 |
| - | 2787179_MatoSpectoru_004bkona_oc_comm_fullcolor_fpsa2_logo.json | 16864 | 2025-07-19 01:08:02 |
| - | 2787179_MatoSpectoru_004bkona_oc_comm_fullcolor_fpsa2_logo.png | 963693 | 2025-07-19 01:08:02 |
| - | 2787447_MatoSpectoru_004ckona_oc_comm_fullcolor_fpsb1_logo.json | 16864 | 2025-07-19 01:08:02 |
| - | 2787447_MatoSpectoru_004ckona_oc_comm_fullcolor_fpsb1_logo.png | 969814 | 2025-07-19 01:08:02 |
| - | 2787449_MatoSpectoru_004dkona_oc_comm_fullcolor_fpsb2_logo.json | 16864 | 2025-07-19 01:08:02 |
| - | 2787449_MatoSpectoru_004dkona_oc_comm_fullcolor_fpsb2_logo.png | 988138 | 2025-07-19 01:08:02 |
| - | 2795623_MatoSpectoru_004bgoodra_patreoncomm_fullcolor_fps_a2_logo.json | 16087 | 2025-07-18 23:20:45 |
| - | 2795623_MatoSpectoru_004bgoodra_patreoncomm_fullcolor_fps_a2_logo.png | 609964 | 2025-07-18 23:20:45 |
| - | 2795626_MatoSpectoru_004dgoodra_patreoncomm_fullcolor_fps_b2_logo.json | 16087 | 2025-07-18 23:20:45 |
| - | 2795626_MatoSpectoru_004dgoodra_patreoncomm_fullcolor_fps_b2_logo.png | 613264 | 2025-07-18 23:20:45 |
| - | 2795628_MatoSpectoru_005bgoodra_patreoncomm_fullcolor_fps_c2_logo.json | 16087 | 2025-07-18 23:20:45 |
| - | 2795628_MatoSpectoru_005bgoodra_patreoncomm_fullcolor_fps_c2_logo.png | 641491 | 2025-07-18 23:20:45 |
| - | 2795632_MatoSpectoru_005dgoodra_patreoncomm_fullcolor_fps_d2_logo.json | 16087 | 2025-07-18 23:20:46 |
| - | 2795632_MatoSpectoru_005dgoodra_patreoncomm_fullcolor_fps_d2_logo.png | 645133 | 2025-07-18 23:20:46 |
| - | 2796559_MatoSpectoru_004bfiera_demongirl_patreoncomm_fullcolor_fps_b_logo.json | 8849 | 2025-07-18 23:10:08 |
| - | 2796559_MatoSpectoru_004bfiera_demongirl_patreoncomm_fullcolor_fps_b_logo.png | 785029 | 2025-07-18 23:10:08 |
| - | 2806342_MatoSpectoru_004amu-shi_hui-min_lei-yin_milk_fullcolorcomm_fps_logo.json | 22060 | 2025-07-18 21:08:21 |
| - | 2806342_MatoSpectoru_004amu-shi_hui-min_lei-yin_milk_fullcolorcomm_fps_logo.png | 1216931 | 2025-07-18 21:08:21 |
| - | 2806545_MatoSpectoru_004cmu-shi_hui-min_lei-yin_milk_fullcolorcomm_fpscum_logo.json | 22060 | 2025-07-18 21:08:24 |
| - | 2806545_MatoSpectoru_004cmu-shi_hui-min_lei-yin_milk_fullcolorcomm_fpscum_logo.png | 1239642 | 2025-07-18 21:08:24 |
| - | 2806549_MatoSpectoru_004bhui-min_bj_patreoncomm_fullcolor_fpsb_logo.json | 22060 | 2025-07-18 21:08:25 |
| - | 2806549_MatoSpectoru_004bhui-min_bj_patreoncomm_fullcolor_fpsb_logo.png | 734826 | 2025-07-18 21:08:25 |
| - | 2806550_MatoSpectoru_004chui-min_bj_patreoncomm_fullcolor_fpsc_logo.json | 22060 | 2025-07-18 21:08:26 |
| - | 2806550_MatoSpectoru_004chui-min_bj_patreoncomm_fullcolor_fpsc_logo.png | 743698 | 2025-07-18 21:08:26 |
| - | 2806552_MatoSpectoru_004bmu-shi_bj_patreoncomm_fullcolor_crop_f_psb_logo.json | 22060 | 2025-07-18 21:08:26 |
| - | 2806552_MatoSpectoru_004bmu-shi_bj_patreoncomm_fullcolor_crop_f_psb_logo.png | 689710 | 2025-07-18 21:08:26 |
| - | 2806553_MatoSpectoru_004cmu-shi_bj_patreoncomm_fullcolor_crop_f_psc_logo.json | 22060 | 2025-07-18 21:08:27 |
| - | 2806553_MatoSpectoru_004cmu-shi_bj_patreoncomm_fullcolor_crop_f_psc_logo.png | 693732 | 2025-07-18 21:08:27 |
| - | 2834039_MatoSpectoru_004karin_bigheart_patreoncomm_fullcolorfpslogo.json | 12624 | 2025-07-18 15:35:36 |
| - | 2834039_MatoSpectoru_004karin_bigheart_patreoncomm_fullcolorfpslogo.png | 532679 | 2025-07-18 15:35:36 |
| - | 2834045_MatoSpectoru_005karin_bigheart_patreoncomm_fullcolorfpscumlogo.json | 12624 | 2025-07-18 15:35:37 |
| - | 2834045_MatoSpectoru_005karin_bigheart_patreoncomm_fullcolorfpscumlogo.png | 596202 | 2025-07-18 15:35:37 |
| - | 2851493_MatoSpectoru_004anila_stern_patreoncomm_fullcolor_fps_logo.json | 12456 | 2025-07-18 12:17:01 |
| - | 2851493_MatoSpectoru_004anila_stern_patreoncomm_fullcolor_fps_logo.png | 614919 | 2025-07-18 12:17:01 |
| - | 2851494_MatoSpectoru_004bnila_stern_patreoncomm_fullcolor_fps_cum_logo.json | 12456 | 2025-07-18 12:17:01 |
| - | 2851494_MatoSpectoru_004bnila_stern_patreoncomm_fullcolor_fps_cum_logo.png | 718375 | 2025-07-18 12:17:01 |
| - | 2859090_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_01_logo.json | 21154 | 2025-07-18 10:50:21 |
| - | 2859090_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_01_logo.png | 645540 | 2025-07-18 10:50:21 |
| - | 2859091_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_03_logo.json | 21154 | 2025-07-18 10:50:21 |
| - | 2859091_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_03_logo.png | 692367 | 2025-07-18 10:50:21 |
| - | 2859092_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_03b_logo.json | 21154 | 2025-07-18 10:50:21 |
| - | 2859092_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_03b_logo.png | 789206 | 2025-07-18 10:50:21 |
| - | 2859093_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_04_logo.json | 21154 | 2025-07-18 10:50:21 |
| - | 2859093_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_04_logo.png | 606292 | 2025-07-18 10:50:21 |
| - | 2859094_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_05_logo.json | 21154 | 2025-07-18 10:50:22 |
| - | 2859094_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_05_logo.png | 628851 | 2025-07-18 10:50:22 |
| - | 2859095_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_10_logo.json | 21154 | 2025-07-18 10:50:22 |
| - | 2859095_MatoSpectoru_muffet_buststyle_patreoncomm_fullcolor_f_ps_10_logo.png | 652825 | 2025-07-18 10:50:22 |
| - | 2862232_MatoSpectoru_004goodra2_patreoncomm_fullcolor_fpsb_logo.json | 8979 | 2025-07-18 10:12:21 |
| - | 2862232_MatoSpectoru_004goodra2_patreoncomm_fullcolor_fpsb_logo.png | 691072 | 2025-07-18 10:12:21 |
| - | 2862236_MatoSpectoru_004agoodra3_patreoncomm_fullcolor_fps_a_logo.json | 16699 | 2025-07-18 10:12:18 |
| - | 2862236_MatoSpectoru_004agoodra3_patreoncomm_fullcolor_fps_a_logo.png | 578039 | 2025-07-18 10:12:18 |
| - | 2862237_MatoSpectoru_004bgoodra3_patreoncomm_fullcolor_fps_b_logo.json | 16699 | 2025-07-18 10:12:18 |
| - | 2862237_MatoSpectoru_004bgoodra3_patreoncomm_fullcolor_fps_b_logo.png | 642023 | 2025-07-18 10:12:18 |
| - | 2862238_MatoSpectoru_005agoodra3_patreoncomm_fullcolor_fps_cum_a_logo.json | 16699 | 2025-07-18 10:12:19 |
| - | 2862238_MatoSpectoru_005agoodra3_patreoncomm_fullcolor_fps_cum_a_logo.png | 645165 | 2025-07-18 10:12:19 |
| - | 2862240_MatoSpectoru_005bgoodra3_patreoncomm_fullcolor_fps_cum_b_logo.json | 16699 | 2025-07-18 10:12:19 |
| - | 2862240_MatoSpectoru_005bgoodra3_patreoncomm_fullcolor_fps_cum_b_logo.png | 655579 | 2025-07-18 10:12:19 |
| - | 2865500_MatoSpectoru_rouge_x_shade_comm_sketch_f_2.0_logo.json | 11087 | 2025-07-18 09:28:08 |
| - | 2865500_MatoSpectoru_rouge_x_shade_comm_sketch_f_2.0_logo.png | 485506 | 2025-07-18 09:28:08 |
| - | 2865501_MatoSpectoru_rouge_x_shade_comm_sketch_fb_2.0_logo.json | 11087 | 2025-07-18 09:28:08 |
| - | 2865501_MatoSpectoru_rouge_x_shade_comm_sketch_fb_2.0_logo.png | 450418 | 2025-07-18 09:28:08 |
| - | 2866925_MatoSpectoru_004achihara_oc_patreoncomm_fullcolor_fpsf_logo2.0.json | 12443 | 2025-07-18 09:09:40 |
| - | 2866925_MatoSpectoru_004achihara_oc_patreoncomm_fullcolor_fpsf_logo2.0.png | 746653 | 2025-07-18 09:09:40 |
| - | 2866928_MatoSpectoru_004bchihara_oc_patreoncomm_fullcolor_fps_cum_logo2.0.json | 12443 | 2025-07-18 09:09:40 |
| - | 2866928_MatoSpectoru_004bchihara_oc_patreoncomm_fullcolor_fps_cum_logo2.0.png | 758374 | 2025-07-18 09:09:40 |
| - | 2877372_MatoSpectoru_004apixxy_x_moraka_comm_fullcolor_fpsa1_logo.json | 16677 | 2025-07-18 07:15:12 |
| - | 2877372_MatoSpectoru_004apixxy_x_moraka_comm_fullcolor_fpsa1_logo.png | 932378 | 2025-07-18 07:15:12 |
| - | 2877373_MatoSpectoru_005bpixxy_x_moraka_comm_fullcolor_fb1psb_logo.json | 16677 | 2025-07-18 07:15:13 |
| - | 2877373_MatoSpectoru_005bpixxy_x_moraka_comm_fullcolor_fb1psb_logo.png | 1021176 | 2025-07-18 07:15:13 |
| - | 2877374_MatoSpectoru_006apixxy_x_moraka_comm_fullcolor_fpsa2_logo.json | 16677 | 2025-07-18 07:15:13 |
| - | 2877374_MatoSpectoru_006apixxy_x_moraka_comm_fullcolor_fpsa2_logo.png | 918987 | 2025-07-18 07:15:13 |
| - | 2877375_MatoSpectoru_008apixxy_x_moraka_comm_fullcolor_fpsa2cumc_logo.json | 16677 | 2025-07-18 07:15:13 |
| - | 2877375_MatoSpectoru_008apixxy_x_moraka_comm_fullcolor_fpsa2cumc_logo.png | 1035288 | 2025-07-18 07:15:13 |
| - | 2878562_MatoSpectoru_004avalkyrie_pheromosa_comm_fullcolor_faps_logo.json | 12872 | 2025-07-18 07:03:05 |
| - | 2878562_MatoSpectoru_004avalkyrie_pheromosa_comm_fullcolor_faps_logo.png | 723639 | 2025-07-18 07:03:05 |
| - | 2878571_MatoSpectoru_004bvalkyrie_pheromosa_comm_fullcolor_fbps_logo.json | 12872 | 2025-07-18 07:03:05 |
| - | 2878571_MatoSpectoru_004bvalkyrie_pheromosa_comm_fullcolor_fbps_logo.png | 767971 | 2025-07-18 07:03:05 |
| - | 2912582_MatoSpectoru_004aluvalind_blue_oc_patreoncomm_fullcolor_faps_logo.json | 11175 | 2025-07-18 00:44:59 |
| - | 2912582_MatoSpectoru_004aluvalind_blue_oc_patreoncomm_fullcolor_faps_logo.png | 670366 | 2025-07-18 00:44:59 |
| - | 2912630_MatoSpectoru_004bluvalind_blue_oc_patreoncomm_fullcolor_fbps_logo.json | 11175 | 2025-07-18 00:44:59 |
| - | 2912630_MatoSpectoru_004bluvalind_blue_oc_patreoncomm_fullcolor_fbps_logo.png | 806086 | 2025-07-18 00:44:59 |
| - | 2925120_MatoSpectoru_004nemo_oc_comm_fullcolor_fpsf_logo.json | 8296 | 2025-07-17 22:28:59 |
| - | 2925120_MatoSpectoru_004nemo_oc_comm_fullcolor_fpsf_logo.png | 841694 | 2025-07-17 22:28:59 |
| - | 2932507_MatoSpectoru_004aamy_rose_np_patreoncomm_fullcolor_psf.json | 13088 | 2025-07-18 00:16:26 |
| - | 2932507_MatoSpectoru_004aamy_rose_np_patreoncomm_fullcolor_psf.png | 627977 | 2025-07-18 00:16:26 |
| - | 2932509_MatoSpectoru_004bamy_rose_np_patreoncomm_fullcolor_psf_cum.json | 13088 | 2025-07-18 00:16:27 |
| - | 2932509_MatoSpectoru_004bamy_rose_np_patreoncomm_fullcolor_psf_cum.png | 687205 | 2025-07-18 00:16:27 |
| - | 2932528_MatoSpectoru_004aamy_rose_hd_comm_fullcolor_ftaps2.0.json | 16490 | 2025-07-18 10:39:44 |
| - | 2932528_MatoSpectoru_004aamy_rose_hd_comm_fullcolor_ftaps2.0.png | 668606 | 2025-07-18 10:39:44 |
| - | 2932532_MatoSpectoru_004bamy_rose_hd_comm_fullcolor_ftaps2.0cum.json | 16490 | 2025-07-18 10:39:44 |
| - | 2932532_MatoSpectoru_004bamy_rose_hd_comm_fullcolor_ftaps2.0cum.png | 672804 | 2025-07-18 10:39:44 |
| - | 2932533_MatoSpectoru_005aamy_rose_hd_comm_fullcolor_ftbps2.0.json | 16490 | 2025-07-18 10:39:45 |
| - | 2932533_MatoSpectoru_005aamy_rose_hd_comm_fullcolor_ftbps2.0.png | 626824 | 2025-07-18 10:39:45 |
| - | 2932535_MatoSpectoru_005bamy_rose_hd_comm_fullcolor_ftbps2.0cum.json | 16490 | 2025-07-18 10:39:45 |
| - | 2932535_MatoSpectoru_005bamy_rose_hd_comm_fullcolor_ftbps2.0cum.png | 630957 | 2025-07-18 10:39:45 |
| - | 2932537_MatoSpectoru_004amy_rose_bust_patreoncomm_fullcolor_fps_2.0.json | 8555 | 2025-07-18 10:28:51 |
| - | 2932537_MatoSpectoru_004amy_rose_bust_patreoncomm_fullcolor_fps_2.0.png | 773587 | 2025-07-18 10:28:51 |
| - | 2932538_MatoSpectoru_fiona_fox_patreoncomm_fullcolor_fps.json | 12113 | 2025-07-18 10:28:48 |
| - | 2932538_MatoSpectoru_fiona_fox_patreoncomm_fullcolor_fps.png | 737399 | 2025-07-18 10:28:48 |
| - | 2932549_MatoSpectoru_amy_rose_x_fiona_bust_patreoncomm_fullcolor_fps.json | 12113 | 2025-07-18 10:28:49 |
| - | 2932549_MatoSpectoru_amy_rose_x_fiona_bust_patreoncomm_fullcolor_fps.png | 500265 | 2025-07-18 10:28:49 |
| - | 2932553_MatoSpectoru_004aamy_rose_patreoncomm_fullcolor_psaf.json | 15660 | 2025-07-19 06:37:34 |
| - | 2932553_MatoSpectoru_004aamy_rose_patreoncomm_fullcolor_psaf.png | 644199 | 2025-07-19 06:37:34 |
| - | 2932556_MatoSpectoru_004bamy_rose_patreoncomm_fullcolor_psc.json | 15660 | 2025-07-19 06:37:34 |
| - | 2932556_MatoSpectoru_004bamy_rose_patreoncomm_fullcolor_psc.png | 865107 | 2025-07-19 06:37:34 |
| - | 2932560_MatoSpectoru_004camy_rose_patreoncomm_fullcolor_psb.json | 15660 | 2025-07-19 06:37:34 |
| - | 2932560_MatoSpectoru_004camy_rose_patreoncomm_fullcolor_psb.png | 839555 | 2025-07-19 06:37:34 |
| - | 2932564_MatoSpectoru_004damy_rose_patreoncomm_fullcolor_psb_creampie.json | 15660 | 2025-07-19 06:37:34 |
| - | 2932564_MatoSpectoru_004damy_rose_patreoncomm_fullcolor_psb_creampie.png | 678701 | 2025-07-19 06:37:34 |
| - | 2932584_MatoSpectoru_004aminamongoosebustfullcolor_01.json | 16065 | 2025-07-19 16:00:35 |
| - | 2932584_MatoSpectoru_004aminamongoosebustfullcolor_01.png | 544914 | 2025-07-19 16:00:35 |
| - | 2932585_MatoSpectoru_006aminamongoosebustfullcolor_09.json | 16065 | 2025-07-19 16:00:35 |
| - | 2932585_MatoSpectoru_006aminamongoosebustfullcolor_09.png | 515260 | 2025-07-19 16:00:35 |
| - | 2932587_MatoSpectoru_2737906_matospectoru_004afrapterxhui-minpatreoncommfullcolorglassesfpslogo.json | 12937 | 2025-07-19 09:52:41 |
| - | 2932587_MatoSpectoru_2737906_matospectoru_004afrapterxhui-minpatreoncommfullcolorglassesfpslogo.png | 491292 | 2025-07-19 09:52:41 |
| - | 2932588_MatoSpectoru_006bminamongoosebustfullcolor_10.json | 16065 | 2025-07-19 16:00:35 |
| - | 2932588_MatoSpectoru_006bminamongoosebustfullcolor_10.png | 576309 | 2025-07-19 16:00:35 |
| - | 2932589_MatoSpectoru_006cminamongoosebustfullcolornudebcum.json | 16065 | 2025-07-19 16:00:36 |
| - | 2932589_MatoSpectoru_006cminamongoosebustfullcolornudebcum.png | 712858 | 2025-07-19 16:00:36 |
| - | 2932591_MatoSpectoru_2737910_matospectoru_005afrapterxhui-minpatreoncommfullcolorglassesfpscumlogo.json | 12937 | 2025-07-19 09:52:42 |
| - | 2932591_MatoSpectoru_2737910_matospectoru_005afrapterxhui-minpatreoncommfullcolorglassesfpscumlogo.png | 521865 | 2025-07-19 09:52:42 |
| - | 2932593_MatoSpectoru_004fionafoxpatreoncommfullcolorfps.json | 8296 | 2025-07-20 02:57:31 |
| - | 2932593_MatoSpectoru_004fionafoxpatreoncommfullcolorfps.png | 653693 | 2025-07-20 02:57:31 |
| - | 2932595_MatoSpectoru_001ahui-minxhumanpatreoncommfullcolorpsnoglassesblogoib.json | 16272 | 2025-07-20 12:11:33 |
| - | 2932595_MatoSpectoru_001ahui-minxhumanpatreoncommfullcolorpsnoglassesblogoib.png | 694206 | 2025-07-20 12:11:33 |
| - | 2932596_MatoSpectoru_001bhui-minxhumanpatreoncommfullcolorpscumlogoib.json | 16272 | 2025-07-20 12:11:33 |
| - | 2932596_MatoSpectoru_001bhui-minxhumanpatreoncommfullcolorpscumlogoib.png | 765834 | 2025-07-20 12:11:33 |
| - | 2932598_MatoSpectoru_002ahui-minxhumanpatreoncommfullcolorpsnoglassesbib.json | 16272 | 2025-07-20 12:11:34 |
| - | 2932598_MatoSpectoru_002ahui-minxhumanpatreoncommfullcolorpsnoglassesbib.png | 754969 | 2025-07-20 12:11:34 |
| - | 2932599_MatoSpectoru_002bhui-minxhumanpatreoncommfullcolorpsnoglassesbcumib.json | 16272 | 2025-07-20 12:11:34 |
| - | 2932599_MatoSpectoru_002bhui-minxhumanpatreoncommfullcolorpsnoglassesbcumib.png | 754706 | 2025-07-20 12:11:34 |
| - | 2932602_MatoSpectoru_72868006_p0.json | 6441 | 2025-07-22 00:34:57 |
| - | 2932602_MatoSpectoru_72868006_p0.png | 857380 | 2025-07-22 00:34:57 |
| - | 2940493_MatoSpectoru_004aamy_bukkake_comm_fullcolor_fpsaf_logo.json | 14570 | 2025-07-17 19:14:43 |
| - | 2940493_MatoSpectoru_004aamy_bukkake_comm_fullcolor_fpsaf_logo.png | 794659 | 2025-07-17 19:14:43 |
| - | 2940495_MatoSpectoru_004bamy_bukkake_comm_fullcolor_fpsbf_logo.json | 14570 | 2025-07-17 19:14:43 |
| - | 2940495_MatoSpectoru_004bamy_bukkake_comm_fullcolor_fpsbf_logo.png | 942571 | 2025-07-17 19:14:43 |
| - | 2940520_MatoSpectoru_004camy_bukkake_comm_fullcolor_fpscf_logo.json | 14570 | 2025-07-17 19:14:43 |
| - | 2940520_MatoSpectoru_004camy_bukkake_comm_fullcolor_fpscf_logo.png | 974178 | 2025-07-17 19:14:43 |
| - | 2945870_MatoSpectoru_004abbeira_dakimakura_comm_fullcolor_crop_abfpsflr_logo.json | 9439 | 2025-07-17 18:18:04 |
| - | 2945870_MatoSpectoru_004abbeira_dakimakura_comm_fullcolor_crop_abfpsflr_logo.png | 854993 | 2025-07-17 18:18:04 |
| - | 2953061_MatoSpectoru_ann_maren_sketch_gift_a.json | 17276 | 2025-07-17 17:01:03 |
| - | 2953061_MatoSpectoru_ann_maren_sketch_gift_a.png | 336462 | 2025-07-17 17:01:03 |
| - | 2953064_MatoSpectoru_ann_maren_sketch_gift_b.json | 17276 | 2025-07-17 17:01:04 |
| - | 2953064_MatoSpectoru_ann_maren_sketch_gift_b.png | 370918 | 2025-07-17 17:01:04 |
| - | 2953067_MatoSpectoru_ann_maren_sketch_gift_c.json | 17276 | 2025-07-17 17:01:04 |
| - | 2953067_MatoSpectoru_ann_maren_sketch_gift_c.png | 382468 | 2025-07-17 17:01:04 |
| - | 2953068_MatoSpectoru_ann_maren_sketch_gift_e2.json | 17276 | 2025-07-17 17:01:04 |
| - | 2953068_MatoSpectoru_ann_maren_sketch_gift_e2.png | 401911 | 2025-07-17 17:01:04 |
| - | 2953069_MatoSpectoru_ann_maren_sketch_gift_g.json | 17276 | 2025-07-17 17:01:04 |
| - | 2953069_MatoSpectoru_ann_maren_sketch_gift_g.png | 410747 | 2025-07-17 17:01:04 |
| - | 2967837_MatoSpectoru_004aluvalind_blue_oc_2_patreoncomm_fullcolor_fapsf_logo.json | 11396 | 2025-07-17 14:14:38 |
| - | 2967837_MatoSpectoru_004aluvalind_blue_oc_2_patreoncomm_fullcolor_fapsf_logo.png | 764256 | 2025-07-17 14:14:38 |
| - | 2967841_MatoSpectoru_004bluvalind_blue_oc_2_patreoncomm_fullcolor_fbpsf_logo.json | 11396 | 2025-07-17 14:14:38 |
| - | 2967841_MatoSpectoru_004bluvalind_blue_oc_2_patreoncomm_fullcolor_fbpsf_logo.png | 793276 | 2025-07-17 14:14:38 |
| - | 2967845_MatoSpectoru_004amina_mongoose_patreoncomm_fullcolor_fpspsa_logo.json | 13312 | 2025-07-17 14:14:33 |
| - | 2967845_MatoSpectoru_004amina_mongoose_patreoncomm_fullcolor_fpspsa_logo.png | 735318 | 2025-07-17 14:14:33 |
| - | 2967847_MatoSpectoru_004bmina_mongoose_patreoncomm_fullcolor_fpspscum_logo.json | 13312 | 2025-07-17 14:14:33 |
| - | 2967847_MatoSpectoru_004bmina_mongoose_patreoncomm_fullcolor_fpspscum_logo.png | 811152 | 2025-07-17 14:14:33 |
| - | 2978447_MatoSpectoru_004blei-yin_oc_patreoncomm_december_fullcolor_fps_heart_logo.json | 9195 | 2025-07-17 12:03:36 |
| - | 2978447_MatoSpectoru_004blei-yin_oc_patreoncomm_december_fullcolor_fps_heart_logo.png | 748723 | 2025-07-17 12:03:36 |
| - | 3 Ponys [Comm].json | 9786 | 2019-02-22 01:26:26 |
| - | 3 Ponys [Comm][0].png | 909936 | 2019-02-22 01:26:26 |
| - | 3 Ponys [Comm][1].png | 1069420 | 2019-02-22 01:26:27 |
| - | 3023685_MatoSpectoru_004bbeira_giant_patreoncomm_fullcolor_fpsb_logo.json | 9019 | 2025-07-17 03:56:35 |
| - | 3023685_MatoSpectoru_004bbeira_giant_patreoncomm_fullcolor_fpsb_logo.png | 1053690 | 2025-07-17 03:56:35 |
| - | 3023697_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_01_logo.json | 29229 | 2025-07-17 03:56:25 |
| - | 3023697_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_01_logo.png | 749795 | 2025-07-17 03:56:25 |
| - | 3023698_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_02_logo.json | 29229 | 2025-07-17 03:56:25 |
| - | 3023698_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_02_logo.png | 796316 | 2025-07-17 03:56:25 |
| - | 3023699_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_03_logo.json | 29229 | 2025-07-17 03:56:26 |
| - | 3023699_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_03_logo.png | 798291 | 2025-07-17 03:56:26 |
| - | 3023702_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_04_logo.json | 29229 | 2025-07-17 03:56:26 |
| - | 3023702_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_04_logo.png | 816883 | 2025-07-17 03:56:26 |
| - | 3023703_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_05_logo.json | 29229 | 2025-07-17 03:56:26 |
| - | 3023703_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_05_logo.png | 803616 | 2025-07-17 03:56:26 |
| - | 3023704_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_06_logo.json | 29229 | 2025-07-17 03:56:26 |
| - | 3023704_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_06_logo.png | 829986 | 2025-07-17 03:56:26 |
| - | 3023705_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_07_logo.json | 29229 | 2025-07-17 03:56:26 |
| - | 3023705_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_07_logo.png | 829128 | 2025-07-17 03:56:26 |
| - | 3023706_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_08_logo.json | 29229 | 2025-07-17 03:56:26 |
| - | 3023706_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_08_logo.png | 855369 | 2025-07-17 03:56:26 |
| - | 3023707_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_09_logo.json | 29229 | 2025-07-17 03:56:26 |
| - | 3023707_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_09_logo.png | 841446 | 2025-07-17 03:56:26 |
| - | 3023708_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_10_logo.json | 29229 | 2025-07-17 03:56:27 |
| - | 3023708_MatoSpectoru_delphox_bust_style_patreoncomm_fullcolor_ps_10_logo.png | 867922 | 2025-07-17 03:56:27 |
| - | 3024165_MatoSpectoru_blaze_the_cat_ms_comm_flatcolor_f_bps_logo.json | 12456 | 2025-07-17 03:47:52 |
| - | 3024165_MatoSpectoru_blaze_the_cat_ms_comm_flatcolor_f_bps_logo.png | 614160 | 2025-07-17 03:47:52 |
| - | 3024167_MatoSpectoru_blaze_the_cat_ms_comm_flatcolor_f_aps_logo.json | 12456 | 2025-07-17 03:47:52 |
| - | 3024167_MatoSpectoru_blaze_the_cat_ms_comm_flatcolor_f_aps_logo.png | 618459 | 2025-07-17 03:47:52 |
| - | 3024182_MatoSpectoru_004bsaggita_yu-gi-oh_patreoncomm_fullcolor_fpsb_nip_logo.json | 12960 | 2025-07-17 03:47:39 |
| - | 3024182_MatoSpectoru_004bsaggita_yu-gi-oh_patreoncomm_fullcolor_fpsb_nip_logo.png | 914909 | 2025-07-17 03:47:39 |
| - | 3024183_MatoSpectoru_004bsaggita_yu-gi-oh_patreoncomm_fullcolor_fpsb_logo.json | 12960 | 2025-07-17 03:47:39 |
| - | 3024183_MatoSpectoru_004bsaggita_yu-gi-oh_patreoncomm_fullcolor_fpsb_logo.png | 914401 | 2025-07-17 03:47:39 |
| - | 3024186_MatoSpectoru_fiona_fox_patreoncomm_fullcolor_fpsa2_logo.json | 12474 | 2025-07-17 03:47:36 |
| - | 3024186_MatoSpectoru_fiona_fox_patreoncomm_fullcolor_fpsa2_logo.png | 924561 | 2025-07-17 03:47:36 |
| - | 3024190_MatoSpectoru_fiona_fox_patreoncomm_fullcolor_fpsb2_logo.json | 12474 | 2025-07-17 03:47:37 |
| - | 3024190_MatoSpectoru_fiona_fox_patreoncomm_fullcolor_fpsb2_logo.png | 937269 | 2025-07-17 03:47:37 |
| - | 3024192_MatoSpectoru_queen_alicia_acorn_patreoncomm_fullcolor_fpsb_logo.json | 9264 | 2025-07-17 03:47:29 |
| - | 3024192_MatoSpectoru_queen_alicia_acorn_patreoncomm_fullcolor_fpsb_logo.png | 858749 | 2025-07-17 03:47:29 |
| - | 3024196_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsa001_logo.json | 25058 | 2025-07-17 03:47:22 |
| - | 3024196_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsa001_logo.png | 1641022 | 2025-07-17 03:47:22 |
| - | 3024198_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsa008_logo.json | 25058 | 2025-07-17 03:47:20 |
| - | 3024198_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsa008_logo.png | 1600767 | 2025-07-17 03:47:20 |
| - | 3024200_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsa009_logo.json | 25058 | 2025-07-17 03:47:22 |
| - | 3024200_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsa009_logo.png | 1603737 | 2025-07-17 03:47:22 |
| - | 3024201_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsa011_logo.json | 25058 | 2025-07-17 03:47:22 |
| - | 3024201_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsa011_logo.png | 1617669 | 2025-07-17 03:47:22 |
| - | 3024202_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsb004_logo.json | 25058 | 2025-07-17 03:47:22 |
| - | 3024202_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsb004_logo.png | 1579287 | 2025-07-17 03:47:22 |
| - | 3024204_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsb008_logo.json | 25058 | 2025-07-17 03:47:23 |
| - | 3024204_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsb008_logo.png | 1527639 | 2025-07-17 03:47:23 |
| - | 3024205_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsb009_logo.json | 25058 | 2025-07-17 03:47:23 |
| - | 3024205_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsb009_logo.png | 1531921 | 2025-07-17 03:47:23 |
| - | 3024206_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsb011_logo.json | 25058 | 2025-07-17 03:47:25 |
| - | 3024206_MatoSpectoru_maria_gardevoir_oc_patreoncomm_fullcolor_fpsb011_logo.png | 1518622 | 2025-07-17 03:47:25 |
| - | 3024216_MatoSpectoru_cuddle_team_leader_bust_style_comm_fullcolor_ps_01_logo.json | 17322 | 2025-07-17 03:46:49 |
| - | 3024216_MatoSpectoru_cuddle_team_leader_bust_style_comm_fullcolor_ps_01_logo.png | 622094 | 2025-07-17 03:46:49 |
| - | 3024217_MatoSpectoru_cuddle_team_leader_bust_style_comm_fullcolor_ps_02_logo.json | 17322 | 2025-07-17 03:46:49 |
| - | 3024217_MatoSpectoru_cuddle_team_leader_bust_style_comm_fullcolor_ps_02_logo.png | 628461 | 2025-07-17 03:46:49 |
| - | 3024218_MatoSpectoru_cuddle_team_leader_bust_style_comm_fullcolor_ps_03_logo.json | 17322 | 2025-07-17 03:46:50 |
| - | 3024218_MatoSpectoru_cuddle_team_leader_bust_style_comm_fullcolor_ps_03_logo.png | 449932 | 2025-07-17 03:46:50 |
| - | 3024220_MatoSpectoru_cuddle_team_leader_bust_style_comm_fullcolor_ps_04_logo.json | 17322 | 2025-07-17 03:46:50 |
| - | 3024220_MatoSpectoru_cuddle_team_leader_bust_style_comm_fullcolor_ps_04_logo.png | 454547 | 2025-07-17 03:46:50 |
| - | 3024224_MatoSpectoru_zoroark_bust_style_comm_patreon_comm_fullcolor_fps_01_logo.json | 19105 | 2025-07-17 03:46:44 |
| - | 3024224_MatoSpectoru_zoroark_bust_style_comm_patreon_comm_fullcolor_fps_01_logo.png | 606169 | 2025-07-17 03:46:44 |
| - | 3024226_MatoSpectoru_zoroark_bust_style_comm_patreon_comm_fullcolor_fps_03_logo.json | 19105 | 2025-07-17 03:46:44 |
| - | 3024226_MatoSpectoru_zoroark_bust_style_comm_patreon_comm_fullcolor_fps_03_logo.png | 626365 | 2025-07-17 03:46:44 |
| - | 3024227_MatoSpectoru_zoroark_bust_style_comm_patreon_comm_fullcolor_fps_04_logo.json | 19105 | 2025-07-17 03:46:44 |
| - | 3024227_MatoSpectoru_zoroark_bust_style_comm_patreon_comm_fullcolor_fps_04_logo.png | 681649 | 2025-07-17 03:46:44 |
| - | 3024228_MatoSpectoru_zoroark_bust_style_comm_patreon_comm_fullcolor_fps_05_logo.json | 19105 | 2025-07-17 03:46:44 |
| - | 3024228_MatoSpectoru_zoroark_bust_style_comm_patreon_comm_fullcolor_fps_05_logo.png | 608676 | 2025-07-17 03:46:44 |
| - | 3024229_MatoSpectoru_zoroark_bust_style_comm_patreon_comm_fullcolor_fps_06_logo.json | 19105 | 2025-07-17 03:46:44 |
| - | 3024229_MatoSpectoru_zoroark_bust_style_comm_patreon_comm_fullcolor_fps_06_logo.png | 636988 | 2025-07-17 03:46:44 |
| - | 3048166_MatoSpectoru_akane_oc_comm_fullcolor_psf_logo.json | 8443 | 2025-07-16 23:19:18 |
| - | 3048166_MatoSpectoru_akane_oc_comm_fullcolor_psf_logo.png | 840196 | 2025-07-16 23:19:18 |
| - | 3049413_MatoSpectoru_honey_steel_oc_comm_fullcolor_fps.json | 8183 | 2025-07-16 23:04:39 |
| - | 3049413_MatoSpectoru_honey_steel_oc_comm_fullcolor_fps.png | 544686 | 2025-07-16 23:04:39 |
| - | 3049414_MatoSpectoru_fiera_demon_oc_patreoncomm_fullcolor_fps_logo.json | 8714 | 2025-07-16 23:04:38 |
| - | 3049414_MatoSpectoru_fiera_demon_oc_patreoncomm_fullcolor_fps_logo.png | 683606 | 2025-07-16 23:04:38 |
| - | 3049417_MatoSpectoru_umbra_patreoncomm_fullcolor_fpsa_logo.json | 8465 | 2025-07-16 23:04:36 |
| - | 3049417_MatoSpectoru_umbra_patreoncomm_fullcolor_fpsa_logo.png | 655938 | 2025-07-16 23:04:36 |
| - | 3049418_MatoSpectoru_elizabeth_oc_mlp_patreoncomm_fullcolor_fps_a2_logo.json | 15204 | 2025-07-16 23:04:36 |
| - | 3049418_MatoSpectoru_elizabeth_oc_mlp_patreoncomm_fullcolor_fps_a2_logo.png | 1092970 | 2025-07-16 23:04:36 |
| - | 3049420_MatoSpectoru_elizabeth_oc_mlp_patreoncomm_fullcolor_fps_a_logo.json | 15204 | 2025-07-16 23:04:36 |
| - | 3049420_MatoSpectoru_elizabeth_oc_mlp_patreoncomm_fullcolor_fps_a_logo.png | 995396 | 2025-07-16 23:04:36 |
| - | 3049421_MatoSpectoru_elizabeth_oc_mlp_patreoncomm_fullcolor_fps_b2_logo.json | 15204 | 2025-07-16 23:04:35 |
| - | 3049421_MatoSpectoru_elizabeth_oc_mlp_patreoncomm_fullcolor_fps_b2_logo.png | 1099277 | 2025-07-16 23:04:35 |
| - | 3049422_MatoSpectoru_elizabeth_oc_mlp_patreoncomm_fullcolor_fps_b_logo.json | 15204 | 2025-07-16 23:04:35 |
| - | 3049422_MatoSpectoru_elizabeth_oc_mlp_patreoncomm_fullcolor_fps_b_logo.png | 1094470 | 2025-07-16 23:04:35 |
| - | 3053512_MatoSpectoru_pheromosa_patreoncomm_fullcolor_faps3_logo.json | 16499 | 2025-07-16 22:19:06 |
| - | 3053512_MatoSpectoru_pheromosa_patreoncomm_fullcolor_faps3_logo.png | 1050144 | 2025-07-16 22:19:06 |
| - | 3053514_MatoSpectoru_pheromosa_patreoncomm_fullcolor_faps4_logo.json | 16499 | 2025-07-16 22:19:06 |
| - | 3053514_MatoSpectoru_pheromosa_patreoncomm_fullcolor_faps4_logo.png | 1066595 | 2025-07-16 22:19:06 |
| - | 3053516_MatoSpectoru_pheromosa_patreoncomm_fullcolor_fbps3_logo.json | 16499 | 2025-07-16 22:19:06 |
| - | 3053516_MatoSpectoru_pheromosa_patreoncomm_fullcolor_fbps3_logo.png | 826900 | 2025-07-16 22:19:06 |
| - | 3053518_MatoSpectoru_pheromosa_patreoncomm_fullcolor_fbps4_logo.json | 16499 | 2025-07-16 22:19:06 |
| - | 3053518_MatoSpectoru_pheromosa_patreoncomm_fullcolor_fbps4_logo.png | 840489 | 2025-07-16 22:19:06 |
| - | 3086780_MatoSpectoru_cinderace_patreoncomm_fullcolor_psa.json | 16130 | 2025-07-16 16:00:24 |
| - | 3086780_MatoSpectoru_cinderace_patreoncomm_fullcolor_psa.png | 911219 | 2025-07-16 16:00:24 |
| - | 3086785_MatoSpectoru_cinderace_patreoncomm_fullcolor_psa_cum.json | 16130 | 2025-07-16 16:00:24 |
| - | 3086785_MatoSpectoru_cinderace_patreoncomm_fullcolor_psa_cum.png | 1007493 | 2025-07-16 16:00:24 |
| - | 3086789_MatoSpectoru_cinderace_patreoncomm_fullcolor_psa2.json | 16130 | 2025-07-16 16:00:24 |
| - | 3086789_MatoSpectoru_cinderace_patreoncomm_fullcolor_psa2.png | 923044 | 2025-07-16 16:00:24 |
| - | 3086790_MatoSpectoru_cinderace_patreoncomm_fullcolor_psa4_cum.json | 16130 | 2025-07-16 16:00:25 |
| - | 3086790_MatoSpectoru_cinderace_patreoncomm_fullcolor_psa4_cum.png | 1020832 | 2025-07-16 16:00:25 |
| - | 3086798_MatoSpectoru_tikal_the_echidna_patreoncomm_fullcolor_fps_logo.json | 9555 | 2025-07-17 11:58:53 |
| - | 3086798_MatoSpectoru_tikal_the_echidna_patreoncomm_fullcolor_fps_logo.png | 576186 | 2025-07-17 11:58:53 |
| - | 3087260_MatoSpectoru_sticks_the_badger_patreoncomm_fullcolor_fps_logo.json | 15121 | 2025-07-16 15:55:01 |
| - | 3087260_MatoSpectoru_sticks_the_badger_patreoncomm_fullcolor_fps_logo.png | 835988 | 2025-07-16 15:55:01 |
| - | 3087267_MatoSpectoru_sticks_the_badger_patreoncomm_fullcolor_fps_cuma_logo.json | 15121 | 2025-07-16 15:55:01 |
| - | 3087267_MatoSpectoru_sticks_the_badger_patreoncomm_fullcolor_fps_cuma_logo.png | 840867 | 2025-07-16 15:55:01 |
| - | 3087273_MatoSpectoru_sticks_the_badger_patreoncomm_fullcolor_fps_cumb_logo.json | 15121 | 2025-07-16 15:55:01 |
| - | 3087273_MatoSpectoru_sticks_the_badger_patreoncomm_fullcolor_fps_cumb_logo.png | 848305 | 2025-07-16 15:55:01 |
| - | 3088712_MatoSpectoru_cassandra_renamon_comm_fullcolor_renamon_a_ps_logo.json | 25674 | 2025-07-16 15:38:49 |
| - | 3088712_MatoSpectoru_cassandra_renamon_comm_fullcolor_renamon_a_ps_logo.png | 822623 | 2025-07-16 15:38:49 |
| - | 3088713_MatoSpectoru_cassandra_renamon_comm_fullcolor_renamon_a_ps_cum_logo.json | 25674 | 2025-07-16 15:38:49 |
| - | 3088713_MatoSpectoru_cassandra_renamon_comm_fullcolor_renamon_a_ps_cum_logo.png | 896666 | 2025-07-16 15:38:49 |
| - | 3088715_MatoSpectoru_cassandra_renamon_comm_fullcolor_renamon_b_ps_logo.json | 25674 | 2025-07-16 15:38:49 |
| - | 3088715_MatoSpectoru_cassandra_renamon_comm_fullcolor_renamon_b_ps_logo.png | 721499 | 2025-07-16 15:38:49 |
| - | 3088716_MatoSpectoru_cassandra_renamon_comm_fullcolor_renamon_b_ps_cum_logo.json | 25674 | 2025-07-16 15:38:50 |
| - | 3088716_MatoSpectoru_cassandra_renamon_comm_fullcolor_renamon_b_ps_cum_logo.png | 787348 | 2025-07-16 15:38:50 |
| - | 3088719_MatoSpectoru_cassandra_renamon_comm_fullcolor_cassandra_a_ps_logo.json | 25674 | 2025-07-16 15:38:50 |
| - | 3088719_MatoSpectoru_cassandra_renamon_comm_fullcolor_cassandra_a_ps_logo.png | 869726 | 2025-07-16 15:38:50 |
| - | 3088720_MatoSpectoru_cassandra_renamon_comm_fullcolor_cassandra_a_ps_cum_logo.json | 25674 | 2025-07-16 15:38:50 |
| - | 3088720_MatoSpectoru_cassandra_renamon_comm_fullcolor_cassandra_a_ps_cum_logo.png | 961328 | 2025-07-16 15:38:50 |
| - | 3088721_MatoSpectoru_cassandra_renamon_comm_fullcolor_cassandra_b_ps_logo.json | 25674 | 2025-07-16 15:38:50 |
| - | 3088721_MatoSpectoru_cassandra_renamon_comm_fullcolor_cassandra_b_ps_logo.png | 733681 | 2025-07-16 15:38:50 |
| - | 3088722_MatoSpectoru_cassandra_renamon_comm_fullcolor_cassandra_b_ps_cum_logo.json | 25674 | 2025-07-16 15:38:50 |
| - | 3088722_MatoSpectoru_cassandra_renamon_comm_fullcolor_cassandra_b_ps_cum_logo.png | 810170 | 2025-07-16 15:38:50 |
| - | 3088805_MatoSpectoru_cream_the_rabbit_comm_fullcolor_fps.json | 16894 | 2025-07-16 15:38:11 |
| - | 3088805_MatoSpectoru_cream_the_rabbit_comm_fullcolor_fps.png | 952851 | 2025-07-16 15:38:11 |
| - | 3088806_MatoSpectoru_cream_the_rabbit_comm_fullcolor_fps_cum.json | 16894 | 2025-07-16 15:38:11 |
| - | 3088806_MatoSpectoru_cream_the_rabbit_comm_fullcolor_fps_cum.png | 969131 | 2025-07-16 15:38:11 |
| - | 3088807_MatoSpectoru_cream_the_rabbit_comm_fullcolor_fps_cum_milk.json | 16894 | 2025-07-16 15:38:11 |
| - | 3088807_MatoSpectoru_cream_the_rabbit_comm_fullcolor_fps_cum_milk.png | 972377 | 2025-07-16 15:38:11 |
| - | 3088808_MatoSpectoru_cream_the_rabbit_comm_fullcolor_fps_milk.json | 16894 | 2025-07-16 15:38:11 |
| - | 3088808_MatoSpectoru_cream_the_rabbit_comm_fullcolor_fps_milk.png | 956367 | 2025-07-16 15:38:11 |
| - | 3088832_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_01.json | 24557 | 2025-07-16 15:37:54 |
| - | 3088832_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_01.png | 954322 | 2025-07-16 15:37:54 |
| - | 3088834_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_01_glasses.json | 24557 | 2025-07-16 15:37:54 |
| - | 3088834_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_01_glasses.png | 1037238 | 2025-07-16 15:37:54 |
| - | 3088835_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_02.json | 24557 | 2025-07-16 15:37:54 |
| - | 3088835_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_02.png | 958817 | 2025-07-16 15:37:54 |
| - | 3088836_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_02_glasses.json | 24557 | 2025-07-16 15:37:54 |
| - | 3088836_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_02_glasses.png | 1041839 | 2025-07-16 15:37:54 |
| - | 3088838_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_03.json | 24557 | 2025-07-16 15:37:55 |
| - | 3088838_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_03.png | 938589 | 2025-07-16 15:37:55 |
| - | 3088840_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_03_glasses.json | 24557 | 2025-07-16 15:37:55 |
| - | 3088840_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_03_glasses.png | 1019004 | 2025-07-16 15:37:55 |
| - | 3088841_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_04.json | 24557 | 2025-07-16 15:37:55 |
| - | 3088841_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_04.png | 950464 | 2025-07-16 15:37:55 |
| - | 3088842_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_04_glasses.json | 24557 | 2025-07-16 15:37:55 |
| - | 3088842_MatoSpectoru_isabelle_gift_spindlesx_fullcolor_fps_04_glasses.png | 1032155 | 2025-07-16 15:37:55 |
| - | 3127997_MatoSpectoru_charlotte_butler_oc_comm_fullcolor_f2ps_logo.json | 11226 | 2025-07-16 08:27:03 |
| - | 3127997_MatoSpectoru_charlotte_butler_oc_comm_fullcolor_f2ps_logo.png | 1211453 | 2025-07-16 08:27:03 |
| - | 3127999_MatoSpectoru_charlotte_butler_oc_comm_fullcolor_f1ps_logo.json | 11226 | 2025-07-16 08:27:03 |
| - | 3127999_MatoSpectoru_charlotte_butler_oc_comm_fullcolor_f1ps_logo.png | 1080963 | 2025-07-16 08:27:03 |
| - | 3128005_MatoSpectoru_janice_lyall_comm_fullcolor_1_fpsa.json | 23527 | 2025-07-16 08:26:58 |
| - | 3128005_MatoSpectoru_janice_lyall_comm_fullcolor_1_fpsa.png | 980877 | 2025-07-16 08:26:58 |
| - | 3128008_MatoSpectoru_janice_lyall_comm_fullcolor_1_fpsb.json | 23527 | 2025-07-16 08:26:58 |
| - | 3128008_MatoSpectoru_janice_lyall_comm_fullcolor_1_fpsb.png | 1046044 | 2025-07-16 08:26:58 |
| - | 3128009_MatoSpectoru_janice_lyall_comm_fullcolor_1_fpsc.json | 23527 | 2025-07-16 08:26:58 |
| - | 3128009_MatoSpectoru_janice_lyall_comm_fullcolor_1_fpsc.png | 1042566 | 2025-07-16 08:26:58 |
| - | 3128010_MatoSpectoru_janice_lyall_comm_fullcolor_1_fpsc2.json | 23527 | 2025-07-16 08:26:58 |
| - | 3128010_MatoSpectoru_janice_lyall_comm_fullcolor_1_fpsc2.png | 935268 | 2025-07-16 08:26:58 |
| - | 3128011_MatoSpectoru_janice_lyall_comm_fullcolor_1_fpsc3_cum.json | 23527 | 2025-07-16 08:26:59 |
| - | 3128011_MatoSpectoru_janice_lyall_comm_fullcolor_1_fpsc3_cum.png | 1054633 | 2025-07-16 08:26:59 |
| - | 3128012_MatoSpectoru_janice_lyall_comm_fullcolor_2_fps.json | 23527 | 2025-07-16 08:26:59 |
| - | 3128012_MatoSpectoru_janice_lyall_comm_fullcolor_2_fps.png | 852963 | 2025-07-16 08:26:59 |
| - | 3128013_MatoSpectoru_janice_lyall_comm_fullcolor_2_fps_text.json | 23527 | 2025-07-16 08:26:59 |
| - | 3128013_MatoSpectoru_janice_lyall_comm_fullcolor_2_fps_text.png | 880050 | 2025-07-16 08:26:59 |
| - | 3128015_MatoSpectoru_janice_lyall_comm_fullcolor_2_fpsc_cum.json | 23527 | 2025-07-16 08:26:59 |
| - | 3128015_MatoSpectoru_janice_lyall_comm_fullcolor_2_fpsc_cum.png | 855536 | 2025-07-16 08:26:59 |
| - | 3128018_MatoSpectoru_cirli_the_imp_comm_flatcolor_fps_logo.json | 8195 | 2025-07-16 08:26:55 |
| - | 3128018_MatoSpectoru_cirli_the_imp_comm_flatcolor_fps_logo.png | 741855 | 2025-07-16 08:26:55 |
| - | 3128022_MatoSpectoru_lina_the_ghoul_comm_fullcolor_fps_logo.json | 8871 | 2025-07-16 08:26:52 |
| - | 3128022_MatoSpectoru_lina_the_ghoul_comm_fullcolor_fps_logo.png | 805439 | 2025-07-16 08:26:52 |
| - | 3128029_MatoSpectoru_serenity_the_gardevoir_oc_comm_fullcolor_fps_a.json | 9800 | 2025-07-16 08:26:47 |
| - | 3128029_MatoSpectoru_serenity_the_gardevoir_oc_comm_fullcolor_fps_a.png | 808999 | 2025-07-16 08:26:47 |
| - | 3128030_MatoSpectoru_serenity_the_gardevoir_oc_comm_fullcolor_fps_b.json | 9800 | 2025-07-16 08:26:47 |
| - | 3128030_MatoSpectoru_serenity_the_gardevoir_oc_comm_fullcolor_fps_b.png | 904556 | 2025-07-16 08:26:47 |
| - | 3128032_MatoSpectoru_poppy_x_tristana_comm_fullcolor_fps_logo.json | 8912 | 2025-07-16 08:26:45 |
| - | 3128032_MatoSpectoru_poppy_x_tristana_comm_fullcolor_fps_logo.png | 839096 | 2025-07-16 08:26:45 |
| - | 3128043_MatoSpectoru_cabal_futa_patreoncomm_fullcolor_fps_a_nips_logo.json | 14528 | 2025-07-16 08:26:40 |
| - | 3128043_MatoSpectoru_cabal_futa_patreoncomm_fullcolor_fps_a_nips_logo.png | 926066 | 2025-07-16 08:26:40 |
| - | 3128046_MatoSpectoru_cabal_futa_patreoncomm_fullcolor_fps_b_nips_logo.json | 14528 | 2025-07-16 08:26:40 |
| - | 3128046_MatoSpectoru_cabal_futa_patreoncomm_fullcolor_fps_b_nips_logo.png | 962577 | 2025-07-16 08:26:40 |
| - | 3128059_MatoSpectoru_cabal_futa_patreoncomm_fullcolor_fps_b_nips_cum_logo.json | 14528 | 2025-07-16 08:26:40 |
| - | 3128059_MatoSpectoru_cabal_futa_patreoncomm_fullcolor_fps_b_nips_cum_logo.png | 965098 | 2025-07-16 08:26:40 |
| - | 3128063_MatoSpectoru_umbra_4_patreoncomm_fullcolor_fps_logo.json | 12406 | 2025-07-16 08:26:33 |
| - | 3128063_MatoSpectoru_umbra_4_patreoncomm_fullcolor_fps_logo.png | 798899 | 2025-07-16 08:26:33 |
| - | 3128065_MatoSpectoru_umbra_4_patreoncomm_fullcolor_fps_futa_heart_logo.json | 12406 | 2025-07-16 08:26:33 |
| - | 3128065_MatoSpectoru_umbra_4_patreoncomm_fullcolor_fps_futa_heart_logo.png | 936318 | 2025-07-16 08:26:33 |
| - | 3128071_MatoSpectoru_chrysalis_patreoncomm_fullcolor_fps_a2_logo.json | 12389 | 2025-07-16 08:26:28 |
| - | 3128071_MatoSpectoru_chrysalis_patreoncomm_fullcolor_fps_a2_logo.png | 997334 | 2025-07-16 08:26:28 |
| - | 3128073_MatoSpectoru_chrysalis_patreoncomm_fullcolor_fps_b2_logo.json | 12389 | 2025-07-16 08:26:28 |
| - | 3128073_MatoSpectoru_chrysalis_patreoncomm_fullcolor_fps_b2_logo.png | 1007522 | 2025-07-16 08:26:28 |
| - | 3128076_MatoSpectoru_chitin_oc_patreoncomm_fullcolor_fbps_logo.json | 11993 | 2025-07-16 08:26:24 |
| - | 3128076_MatoSpectoru_chitin_oc_patreoncomm_fullcolor_fbps_logo.png | 1075846 | 2025-07-16 08:26:24 |
| - | 3128077_MatoSpectoru_chitin_oc_patreoncomm_fullcolor_faps_logo.json | 11993 | 2025-07-16 08:26:25 |
| - | 3128077_MatoSpectoru_chitin_oc_patreoncomm_fullcolor_faps_logo.png | 1008487 | 2025-07-16 08:26:25 |
| - | 3128083_MatoSpectoru_lei-yin_bj_patreoncomm_fullcolor_fpsa_logo.json | 16142 | 2025-07-16 08:26:19 |
| - | 3128083_MatoSpectoru_lei-yin_bj_patreoncomm_fullcolor_fpsa_logo.png | 1017624 | 2025-07-16 08:26:19 |
| - | 3128084_MatoSpectoru_lei-yin_bj_patreoncomm_fullcolor_fpsb_logo.json | 16142 | 2025-07-16 08:26:19 |
| - | 3128084_MatoSpectoru_lei-yin_bj_patreoncomm_fullcolor_fpsb_logo.png | 1021519 | 2025-07-16 08:26:19 |
| - | 3128085_MatoSpectoru_lei-yin_bj_patreoncomm_fullcolor_fpsc_logo.json | 16142 | 2025-07-16 08:26:20 |
| - | 3128085_MatoSpectoru_lei-yin_bj_patreoncomm_fullcolor_fpsc_logo.png | 1024681 | 2025-07-16 08:26:20 |
| - | 3128086_MatoSpectoru_lei-yin_bj_patreoncomm_fullcolor_fpsd_logo.json | 16142 | 2025-07-16 08:26:20 |
| - | 3128086_MatoSpectoru_lei-yin_bj_patreoncomm_fullcolor_fpsd_logo.png | 1028636 | 2025-07-16 08:26:20 |
| - | 3128090_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_a_cum_logo.json | 19916 | 2025-07-16 08:26:16 |
| - | 3128090_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_a_cum_logo.png | 868864 | 2025-07-16 08:26:16 |
| - | 3128091_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_a_logo.json | 19916 | 2025-07-16 08:26:16 |
| - | 3128091_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_a_logo.png | 865974 | 2025-07-16 08:26:16 |
| - | 3128093_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_b_cum_logo.json | 19916 | 2025-07-16 08:26:16 |
| - | 3128093_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_b_cum_logo.png | 870882 | 2025-07-16 08:26:16 |
| - | 3128094_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_b_logo.json | 19916 | 2025-07-16 08:26:15 |
| - | 3128094_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_b_logo.png | 867967 | 2025-07-16 08:26:15 |
| - | 3128097_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_c_cum_logo.json | 19916 | 2025-07-16 08:26:15 |
| - | 3128097_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_c_cum_logo.png | 861428 | 2025-07-16 08:26:15 |
| - | 3128098_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_c_logo.json | 19916 | 2025-07-16 08:26:15 |
| - | 3128098_MatoSpectoru_sticks_the_badger_2_patreoncomm_fullcolor_fps_c_logo.png | 857496 | 2025-07-16 08:26:15 |
| - | 3129272_MatoSpectoru_blaziken_patreoncomm_fullcolor_fps_b_heart.json | 12165 | 2025-07-16 08:11:45 |
| - | 3129272_MatoSpectoru_blaziken_patreoncomm_fullcolor_fps_b_heart.png | 945145 | 2025-07-16 08:11:45 |
| - | 3129273_MatoSpectoru_blaziken_patreoncomm_fullcolor_fps_d.json | 12165 | 2025-07-16 08:11:46 |
| - | 3129273_MatoSpectoru_blaziken_patreoncomm_fullcolor_fps_d.png | 945428 | 2025-07-16 08:11:46 |
| - | 3143328_MatoSpectoru_midna_ass_midnass_original_original_ps.json | 12821 | 2025-07-16 05:45:41 |
| - | 3143328_MatoSpectoru_midna_ass_midnass_original_original_ps.png | 782828 | 2025-07-16 05:45:41 |
| - | 3143329_MatoSpectoru_midna_ass_midnass_original_gym_ps.json | 12821 | 2025-07-16 05:45:41 |
| - | 3143329_MatoSpectoru_midna_ass_midnass_original_gym_ps.png | 815548 | 2025-07-16 05:45:41 |
| - | 3162054_MatoSpectoru_mary_sue_oc_patreoncomm_fullcolor_fpsa.json | 11785 | 2025-07-16 02:29:49 |
| - | 3162054_MatoSpectoru_mary_sue_oc_patreoncomm_fullcolor_fpsa.png | 769858 | 2025-07-16 02:29:49 |
| - | 3162055_MatoSpectoru_mary_sue_oc_patreoncomm_fullcolor_fpsb.json | 11785 | 2025-07-16 02:29:49 |
| - | 3162055_MatoSpectoru_mary_sue_oc_patreoncomm_fullcolor_fpsb.png | 736576 | 2025-07-16 02:29:49 |
| - | 3162060_MatoSpectoru_saki_patreoncomm_fullcolor_psb2.json | 16251 | 2025-07-16 02:29:46 |
| - | 3162060_MatoSpectoru_saki_patreoncomm_fullcolor_psb2.png | 1494111 | 2025-07-16 02:29:46 |
| - | 3162122_MatoSpectoru_saki_patreoncomm_fullcolor_psa2.json | 16251 | 2025-07-16 02:29:46 |
| - | 3162122_MatoSpectoru_saki_patreoncomm_fullcolor_psa2.png | 927818 | 2025-07-16 02:29:46 |
| - | 3162139_MatoSpectoru_saki_patreoncomm_fullcolor_psb1.json | 16251 | 2025-07-16 02:29:46 |
| - | 3162139_MatoSpectoru_saki_patreoncomm_fullcolor_psb1.png | 1461425 | 2025-07-16 02:29:46 |
| - | 3162140_MatoSpectoru_saki_patreoncomm_fullcolor_psa1.json | 16251 | 2025-07-16 02:29:46 |
| - | 3162140_MatoSpectoru_saki_patreoncomm_fullcolor_psa1.png | 895077 | 2025-07-16 02:29:46 |
| - | 3165679_MatoSpectoru_mienshao_patreoncomm_fullcolor_1apsf_wet.json | 14079 | 2025-07-16 01:53:02 |
| - | 3165679_MatoSpectoru_mienshao_patreoncomm_fullcolor_1apsf_wet.png | 620398 | 2025-07-16 01:53:02 |
| - | 3165683_MatoSpectoru_mienshao_patreoncomm_fullcolor_1a2psf.json | 14079 | 2025-07-16 01:53:02 |
| - | 3165683_MatoSpectoru_mienshao_patreoncomm_fullcolor_1a2psf.png | 616299 | 2025-07-16 01:53:02 |
| - | 3165685_MatoSpectoru_mienshao_patreoncomm_fullcolor_1a2psf_cum.json | 14079 | 2025-07-16 01:53:03 |
| - | 3165685_MatoSpectoru_mienshao_patreoncomm_fullcolor_1a2psf_cum.png | 628436 | 2025-07-16 01:53:03 |
| - | 3165687_MatoSpectoru_mienshao_patreoncomm_fullcolor_2apsf.json | 12672 | 2025-07-16 01:52:59 |
| - | 3165687_MatoSpectoru_mienshao_patreoncomm_fullcolor_2apsf.png | 578805 | 2025-07-16 01:52:59 |
| - | 3165689_MatoSpectoru_mienshao_patreoncomm_fullcolor_2apsf_cum.json | 12672 | 2025-07-16 01:52:59 |
| - | 3165689_MatoSpectoru_mienshao_patreoncomm_fullcolor_2apsf_cum.png | 638694 | 2025-07-16 01:52:59 |
| - | 3165692_MatoSpectoru_dixie_k_patreoncomm_fullcolor_fpsa.json | 13550 | 2025-07-16 01:52:55 |
| - | 3165692_MatoSpectoru_dixie_k_patreoncomm_fullcolor_fpsa.png | 545943 | 2025-07-16 01:52:55 |
| - | 3165693_MatoSpectoru_dixie_k_patreoncomm_fullcolor_fpsa2.json | 13550 | 2025-07-16 01:52:56 |
| - | 3165693_MatoSpectoru_dixie_k_patreoncomm_fullcolor_fpsa2.png | 629760 | 2025-07-16 01:52:56 |
| - | 3165695_MatoSpectoru_dixie_k_patreoncomm_fullcolor_fpsa3b.json | 13550 | 2025-07-16 01:52:56 |
| - | 3165695_MatoSpectoru_dixie_k_patreoncomm_fullcolor_fpsa3b.png | 617614 | 2025-07-16 01:52:56 |
| - | 3165715_MatoSpectoru_hui-min_patreoncomm_fullcolor_fpsb_logo.json | 11186 | 2025-07-16 01:52:40 |
| - | 3165715_MatoSpectoru_hui-min_patreoncomm_fullcolor_fpsb_logo.png | 817458 | 2025-07-16 01:52:40 |
| - | 3165716_MatoSpectoru_hui-min_patreoncomm_fullcolor_fpsa_logo.json | 11186 | 2025-07-16 01:52:40 |
| - | 3165716_MatoSpectoru_hui-min_patreoncomm_fullcolor_fpsa_logo.png | 738075 | 2025-07-16 01:52:40 |
| - | 3166811_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_01.json | 24237 | 2025-07-16 01:40:49 |
| - | 3166811_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_01.png | 504754 | 2025-07-16 01:40:49 |
| - | 3166812_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_02.json | 24237 | 2025-07-16 01:40:49 |
| - | 3166812_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_02.png | 520517 | 2025-07-16 01:40:49 |
| - | 3166814_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_03.json | 24237 | 2025-07-16 01:40:50 |
| - | 3166814_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_03.png | 535139 | 2025-07-16 01:40:50 |
| - | 3166815_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_04.json | 24237 | 2025-07-16 01:40:50 |
| - | 3166815_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_04.png | 548152 | 2025-07-16 01:40:50 |
| - | 3166816_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_09.json | 24237 | 2025-07-16 01:40:50 |
| - | 3166816_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_09.png | 499394 | 2025-07-16 01:40:50 |
| - | 3166817_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_10.json | 24237 | 2025-07-16 01:40:50 |
| - | 3166817_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_10.png | 512713 | 2025-07-16 01:40:50 |
| - | 3166818_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_11.json | 24237 | 2025-07-16 01:40:50 |
| - | 3166818_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_11.png | 525286 | 2025-07-16 01:40:50 |
| - | 3166819_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_12.json | 24237 | 2025-07-16 01:40:50 |
| - | 3166819_MatoSpectoru_girl_ratchet_and_clank_fullcolor_pack_12.png | 536246 | 2025-07-16 01:40:50 |
| - | 3178973_MatoSpectoru_millie_isis_oc_comm_fullcolor_fps_b.json | 9394 | 2025-07-15 23:28:41 |
| - | 3178973_MatoSpectoru_millie_isis_oc_comm_fullcolor_fps_b.png | 527965 | 2025-07-15 23:28:41 |
| - | 3178976_MatoSpectoru_millie_isis_oc_comm_fullcolor_fps_a.json | 9394 | 2025-07-15 23:28:41 |
| - | 3178976_MatoSpectoru_millie_isis_oc_comm_fullcolor_fps_a.png | 484699 | 2025-07-15 23:28:41 |
| - | 3178994_MatoSpectoru_diabola_oc_character_sheet_patreoncomm_fullcolor_fpsa.json | 11713 | 2025-07-15 23:28:26 |
| - | 3178994_MatoSpectoru_diabola_oc_character_sheet_patreoncomm_fullcolor_fpsa.png | 590899 | 2025-07-15 23:28:26 |
| - | 3178997_MatoSpectoru_diabola_oc_character_sheet_patreoncomm_fullcolor_fpsb.json | 11713 | 2025-07-15 23:28:26 |
| - | 3178997_MatoSpectoru_diabola_oc_character_sheet_patreoncomm_fullcolor_fpsb.png | 636176 | 2025-07-15 23:28:26 |
| - | 3179001_MatoSpectoru_ava_sona_comm_fullcolor_fpsa2.json | 11099 | 2025-07-15 23:28:21 |
| - | 3179001_MatoSpectoru_ava_sona_comm_fullcolor_fpsa2.png | 467801 | 2025-07-15 23:28:21 |
| - | 3179003_MatoSpectoru_ava_sona_comm_fullcolor_fpsa3.json | 11099 | 2025-07-15 23:28:21 |
| - | 3179003_MatoSpectoru_ava_sona_comm_fullcolor_fpsa3.png | 509643 | 2025-07-15 23:28:21 |
| - | 3179007_MatoSpectoru_kaori_yordle_comm_fullcolor_faps.json | 11302 | 2025-07-15 23:28:23 |
| - | 3179007_MatoSpectoru_kaori_yordle_comm_fullcolor_faps.png | 719373 | 2025-07-15 23:28:23 |
| - | 3179013_MatoSpectoru_kaori_yordle_comm_fullcolor_fbps.json | 11302 | 2025-07-15 23:28:23 |
| - | 3179013_MatoSpectoru_kaori_yordle_comm_fullcolor_fbps.png | 693989 | 2025-07-15 23:28:23 |
| - | 3179894_MatoSpectoru_fate_valentine_oc_comm_fullcolor_fps.json | 7862 | 2025-07-15 23:28:35 |
| - | 3179894_MatoSpectoru_fate_valentine_oc_comm_fullcolor_fps.png | 550998 | 2025-07-15 23:28:35 |
| - | 3187099_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsa.json | 19706 | 2025-07-15 21:49:36 |
| - | 3187099_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsa.png | 922890 | 2025-07-15 21:49:36 |
| - | 3187100_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsb.json | 19706 | 2025-07-15 21:49:36 |
| - | 3187100_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsb.png | 925271 | 2025-07-15 21:49:36 |
| - | 3187102_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsc.json | 19706 | 2025-07-15 21:49:36 |
| - | 3187102_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsc.png | 953500 | 2025-07-15 21:49:36 |
| - | 3187168_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsa2.json | 19706 | 2025-07-15 21:49:36 |
| - | 3187168_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsa2.png | 924892 | 2025-07-15 21:49:36 |
| - | 3187169_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsb2.json | 19706 | 2025-07-15 21:49:37 |
| - | 3187169_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsb2.png | 927360 | 2025-07-15 21:49:37 |
| - | 3187170_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsc2.json | 19706 | 2025-07-15 21:49:37 |
| - | 3187170_MatoSpectoru_kalx_inkz_goblin_comm_fullcolor_fpsc2.png | 955817 | 2025-07-15 21:49:37 |
| - | 3196519_MatoSpectoru_ashley_mermaid_fullcolor_psb.json | 12389 | 2025-07-15 20:00:37 |
| - | 3196519_MatoSpectoru_ashley_mermaid_fullcolor_psb.png | 732648 | 2025-07-15 20:00:37 |
| - | 3196523_MatoSpectoru_ashley_salamander_fullcolor_psb.json | 12389 | 2025-07-15 20:00:37 |
| - | 3196523_MatoSpectoru_ashley_salamander_fullcolor_psb.png | 680117 | 2025-07-15 20:00:37 |
| - | 3196524_MatoSpectoru_molly_cunningham_comm_fullcolor_fpsc.json | 15805 | 2025-07-15 20:00:34 |
| - | 3196524_MatoSpectoru_molly_cunningham_comm_fullcolor_fpsc.png | 585987 | 2025-07-15 20:00:34 |
| - | 3196525_MatoSpectoru_molly_cunningham_comm_fullcolor_fpsa.json | 15805 | 2025-07-15 20:00:35 |
| - | 3196525_MatoSpectoru_molly_cunningham_comm_fullcolor_fpsa.png | 565342 | 2025-07-15 20:00:35 |
| - | 3196526_MatoSpectoru_molly_cunningham_comm_fullcolor_fpsb.json | 15805 | 2025-07-15 20:00:35 |
| - | 3196526_MatoSpectoru_molly_cunningham_comm_fullcolor_fpsb.png | 507121 | 2025-07-15 20:00:35 |
| - | 3209133_MatoSpectoru_rouge_the_bat_patreoncomm_sketch_color_aps.json | 16508 | 2025-07-15 17:40:58 |
| - | 3209133_MatoSpectoru_rouge_the_bat_patreoncomm_sketch_color_aps.png | 852202 | 2025-07-15 17:40:58 |
| - | 3209134_MatoSpectoru_rouge_the_bat_patreoncomm_sketch_color_bps.json | 16508 | 2025-07-15 17:40:59 |
| - | 3209134_MatoSpectoru_rouge_the_bat_patreoncomm_sketch_color_bps.png | 892202 | 2025-07-15 17:40:59 |
| - | 3209135_MatoSpectoru_rouge_the_bat_patreoncomm_sketch_color_a2ps.json | 16508 | 2025-07-15 17:40:59 |
| - | 3209135_MatoSpectoru_rouge_the_bat_patreoncomm_sketch_color_a2ps.png | 836643 | 2025-07-15 17:40:59 |
| - | 3209137_MatoSpectoru_rouge_the_bat_patreoncomm_sketch_color_b2ps.json | 16508 | 2025-07-15 17:40:59 |
| - | 3209137_MatoSpectoru_rouge_the_bat_patreoncomm_sketch_color_b2ps.png | 868627 | 2025-07-15 17:40:59 |
| - | 3209141_MatoSpectoru_shirina_oc_comm_fullcolor_fpsa.json | 15562 | 2025-07-15 17:40:55 |
| - | 3209141_MatoSpectoru_shirina_oc_comm_fullcolor_fpsa.png | 508928 | 2025-07-15 17:40:55 |
| - | 3209142_MatoSpectoru_shirina_oc_comm_fullcolor_fpsa2.json | 15562 | 2025-07-15 17:40:55 |
| - | 3209142_MatoSpectoru_shirina_oc_comm_fullcolor_fpsa2.png | 549567 | 2025-07-15 17:40:55 |
| - | 3209155_MatoSpectoru_shirina_oc_comm_fullcolor_fpsb.json | 15562 | 2025-07-15 17:40:55 |
| - | 3209155_MatoSpectoru_shirina_oc_comm_fullcolor_fpsb.png | 526037 | 2025-07-15 17:40:55 |
| - | 3209158_MatoSpectoru_shirina_oc_comm_fullcolor_fpsb2.json | 15562 | 2025-07-15 17:40:56 |
| - | 3209158_MatoSpectoru_shirina_oc_comm_fullcolor_fpsb2.png | 568190 | 2025-07-15 17:40:56 |
| - | 3209161_MatoSpectoru_tigress_comm_fullcolor_fps_01.json | 17633 | 2025-07-15 17:40:46 |
| - | 3209161_MatoSpectoru_tigress_comm_fullcolor_fps_01.png | 507644 | 2025-07-15 17:40:46 |
| - | 3209162_MatoSpectoru_tigress_comm_fullcolor_fps_04.json | 17633 | 2025-07-15 17:40:46 |
| - | 3209162_MatoSpectoru_tigress_comm_fullcolor_fps_04.png | 492431 | 2025-07-15 17:40:46 |
| - | 3209163_MatoSpectoru_tigress_comm_fullcolor_fps_07.json | 17633 | 2025-07-15 17:40:47 |
| - | 3209163_MatoSpectoru_tigress_comm_fullcolor_fps_07.png | 526348 | 2025-07-15 17:40:47 |
| - | 3209164_MatoSpectoru_tigress_comm_fullcolor_fps_10.json | 17633 | 2025-07-15 17:40:46 |
| - | 3209164_MatoSpectoru_tigress_comm_fullcolor_fps_10.png | 778737 | 2025-07-15 17:40:46 |
| - | 3215019_MatoSpectoru_blaziken_pr_comm_fullcolor_fpsa.json | 16574 | 2025-07-15 16:32:02 |
| - | 3215019_MatoSpectoru_blaziken_pr_comm_fullcolor_fpsa.png | 532756 | 2025-07-15 16:32:02 |
| - | 3215022_MatoSpectoru_blaziken_pr_comm_fullcolor_fpsa_mlk.json | 16574 | 2025-07-15 16:32:02 |
| - | 3215022_MatoSpectoru_blaziken_pr_comm_fullcolor_fpsa_mlk.png | 587284 | 2025-07-15 16:32:02 |
| - | 3215024_MatoSpectoru_blaziken_pr_comm_fullcolor_fpsb.json | 16574 | 2025-07-15 16:32:02 |
| - | 3215024_MatoSpectoru_blaziken_pr_comm_fullcolor_fpsb.png | 750856 | 2025-07-15 16:32:02 |
| - | 3215026_MatoSpectoru_blaziken_pr_comm_fullcolor_fpsb_mlk.json | 16574 | 2025-07-15 16:32:02 |
| - | 3215026_MatoSpectoru_blaziken_pr_comm_fullcolor_fpsb_mlk.png | 754230 | 2025-07-15 16:32:02 |
| - | 3222336_MatoSpectoru_dr.voir_comm_fullcolor_fpsa.json | 16399 | 2025-07-15 15:10:46 |
| - | 3222336_MatoSpectoru_dr.voir_comm_fullcolor_fpsa.png | 636420 | 2025-07-15 15:10:46 |
| - | 3222338_MatoSpectoru_dr.voir_comm_fullcolor_fpsa_glasses.json | 16399 | 2025-07-15 15:10:46 |
| - | 3222338_MatoSpectoru_dr.voir_comm_fullcolor_fpsa_glasses.png | 699935 | 2025-07-15 15:10:46 |
| - | 3222339_MatoSpectoru_dr.voir_comm_fullcolor_fpsb.json | 16399 | 2025-07-15 15:10:46 |
| - | 3222339_MatoSpectoru_dr.voir_comm_fullcolor_fpsb.png | 605443 | 2025-07-15 15:10:46 |
| - | 3222340_MatoSpectoru_dr.voir_comm_fullcolor_fpsb_glasses.json | 16399 | 2025-07-15 15:10:46 |
| - | 3222340_MatoSpectoru_dr.voir_comm_fullcolor_fpsb_glasses.png | 663782 | 2025-07-15 15:10:46 |
| - | 3222403_MatoSpectoru_roxanne_comm_fullcolor_fpsa2.json | 15146 | 2025-07-15 15:09:55 |
| - | 3222403_MatoSpectoru_roxanne_comm_fullcolor_fpsa2.png | 534645 | 2025-07-15 15:09:55 |
| - | 3222405_MatoSpectoru_roxanne_comm_fullcolor_fpsa.json | 15146 | 2025-07-15 15:09:56 |
| - | 3222405_MatoSpectoru_roxanne_comm_fullcolor_fpsa.png | 544591 | 2025-07-15 15:09:56 |
| - | 3222406_MatoSpectoru_roxanne_comm_fullcolor_fpsb.json | 15146 | 2025-07-15 15:09:56 |
| - | 3222406_MatoSpectoru_roxanne_comm_fullcolor_fpsb.png | 476351 | 2025-07-15 15:09:56 |
| - | 3232411_MatoSpectoru_coco_4_cb4_pack_ps_04_d_eb.json | 16656 | 2025-07-15 13:33:16 |
| - | 3232411_MatoSpectoru_coco_4_cb4_pack_ps_04_d_eb.png | 700746 | 2025-07-15 13:33:16 |
| - | 3232412_MatoSpectoru_coco_4_cb4_pack_ps_09_eb.json | 16656 | 2025-07-15 13:33:16 |
| - | 3232412_MatoSpectoru_coco_4_cb4_pack_ps_09_eb.png | 719136 | 2025-07-15 13:33:16 |
| - | 3232414_MatoSpectoru_coco_4_cb4_pack_ps_05_d_eb.json | 16656 | 2025-07-15 13:33:16 |
| - | 3232414_MatoSpectoru_coco_4_cb4_pack_ps_05_d_eb.png | 672335 | 2025-07-15 13:33:16 |
| - | 3232415_MatoSpectoru_coco_4_cb4_pack_ps_10_eb.json | 16656 | 2025-07-15 13:33:16 |
| - | 3232415_MatoSpectoru_coco_4_cb4_pack_ps_10_eb.png | 711541 | 2025-07-15 13:33:16 |
| - | 3246527_MatoSpectoru_gauss_oc_comm_fullcolor_faps.json | 11821 | 2025-07-15 10:44:38 |
| - | 3246527_MatoSpectoru_gauss_oc_comm_fullcolor_faps.png | 445202 | 2025-07-15 10:44:38 |
| - | 3246528_MatoSpectoru_gauss_oc_comm_fullcolor_fbps.json | 11821 | 2025-07-15 10:44:39 |
| - | 3246528_MatoSpectoru_gauss_oc_comm_fullcolor_fbps.png | 594546 | 2025-07-15 10:44:39 |
| - | 3249890_MatoSpectoru_kanani_the_toucan_oc_comm_fullcolor_fpsb2.json | 11767 | 2025-07-15 10:03:17 |
| - | 3249890_MatoSpectoru_kanani_the_toucan_oc_comm_fullcolor_fpsb2.png | 675182 | 2025-07-15 10:03:17 |
| - | 3249892_MatoSpectoru_kanani_the_toucan_oc_comm_fullcolor_fpsa2.json | 11767 | 2025-07-15 10:03:18 |
| - | 3249892_MatoSpectoru_kanani_the_toucan_oc_comm_fullcolor_fpsa2.png | 700647 | 2025-07-15 10:03:18 |
| - | 3252834_MatoSpectoru_mu-shi_oc_august_comm_fullcolor_fpsa2.json | 12825 | 2025-07-15 09:26:18 |
| - | 3252834_MatoSpectoru_mu-shi_oc_august_comm_fullcolor_fpsa2.png | 719894 | 2025-07-15 09:26:18 |
| - | 3252835_MatoSpectoru_mu-shi_oc_august_comm_fullcolor_fpsa2_cum.json | 12825 | 2025-07-15 09:26:19 |
| - | 3252835_MatoSpectoru_mu-shi_oc_august_comm_fullcolor_fpsa2_cum.png | 721847 | 2025-07-15 09:26:19 |
| - | 3252837_MatoSpectoru_hui-min_oc_august_comm_fullcolor_fpsa2.json | 12117 | 2025-07-15 09:26:17 |
| - | 3252837_MatoSpectoru_hui-min_oc_august_comm_fullcolor_fpsa2.png | 778441 | 2025-07-15 09:26:17 |
| - | 3252838_MatoSpectoru_hui-min_oc_august_comm_fullcolor_fpsa2_cum_heart.json | 12117 | 2025-07-15 09:26:17 |
| - | 3252838_MatoSpectoru_hui-min_oc_august_comm_fullcolor_fpsa2_cum_heart.png | 716200 | 2025-07-15 09:26:17 |
| - | 3263420_MatoSpectoru_coco_bandicoot_bs_comm_fullcolor_ps_03.json | 18391 | 2025-07-15 07:38:32 |
| - | 3263420_MatoSpectoru_coco_bandicoot_bs_comm_fullcolor_ps_03.png | 519917 | 2025-07-15 07:38:32 |
| - | 3263435_MatoSpectoru_coco_bandicoot_bs_comm_fullcolor_ps_01.json | 18391 | 2025-07-15 07:38:32 |
| - | 3263435_MatoSpectoru_coco_bandicoot_bs_comm_fullcolor_ps_01.png | 515309 | 2025-07-15 07:38:32 |
| - | 3263436_MatoSpectoru_coco_bandicoot_bs_comm_fullcolor_ps_09.json | 18391 | 2025-07-15 07:38:32 |
| - | 3263436_MatoSpectoru_coco_bandicoot_bs_comm_fullcolor_ps_09.png | 530145 | 2025-07-15 07:38:32 |
| - | 3263437_MatoSpectoru_coco_bandicoot_bs_comm_fullcolor_ps_18.json | 18391 | 2025-07-15 07:38:33 |
| - | 3263437_MatoSpectoru_coco_bandicoot_bs_comm_fullcolor_ps_18.png | 464594 | 2025-07-15 07:38:33 |
| - | 3263439_MatoSpectoru_coco_bandicoot_bs_comm_fullcolor_ps_21.json | 18391 | 2025-07-15 07:38:33 |
| - | 3263439_MatoSpectoru_coco_bandicoot_bs_comm_fullcolor_ps_21.png | 550153 | 2025-07-15 07:38:33 |
| - | 3269489_MatoSpectoru_shade_x_rouge_comm_sketch_a.json | 16960 | 2025-07-15 06:35:22 |
| - | 3269489_MatoSpectoru_shade_x_rouge_comm_sketch_a.png | 274616 | 2025-07-15 06:35:22 |
| - | 3269491_MatoSpectoru_shade_x_rouge_comm_sketch_b.json | 16960 | 2025-07-15 06:35:24 |
| - | 3269491_MatoSpectoru_shade_x_rouge_comm_sketch_b.png | 292127 | 2025-07-15 06:35:24 |
| - | 3269493_MatoSpectoru_shade_x_rouge_comm_sketch_c.json | 16960 | 2025-07-15 06:35:25 |
| - | 3269493_MatoSpectoru_shade_x_rouge_comm_sketch_c.png | 291373 | 2025-07-15 06:35:25 |
| - | 3269494_MatoSpectoru_shade_x_rouge_comm_sketch_d.json | 16960 | 2025-07-15 06:35:26 |
| - | 3269494_MatoSpectoru_shade_x_rouge_comm_sketch_d.png | 301419 | 2025-07-15 06:35:26 |
| - | 3270341_MatoSpectoru_acaisha_oc_comm_fullcolor_fps_a.json | 8583 | 2025-07-15 06:25:26 |
| - | 3270341_MatoSpectoru_acaisha_oc_comm_fullcolor_fps_a.png | 517893 | 2025-07-15 06:25:26 |
| - | 3270956_MatoSpectoru_tigress_comm_fullcolor_fps_03.json | 17633 | 2025-07-15 17:40:46 |
| - | 3270956_MatoSpectoru_tigress_comm_fullcolor_fps_03.png | 483557 | 2025-07-15 17:40:46 |
| - | 3271483_MatoSpectoru_poll_sketch_fanbox_subscribestar_crop.json | 8281 | 2025-07-15 06:19:41 |
| - | 3271483_MatoSpectoru_poll_sketch_fanbox_subscribestar_crop.png | 1841702 | 2025-07-15 06:19:41 |
| - | 3276275_MatoSpectoru_tawna_c4_fullcolor_pack_ps_08.json | 18587 | 2025-07-15 05:20:28 |
| - | 3276275_MatoSpectoru_tawna_c4_fullcolor_pack_ps_08.png | 466966 | 2025-07-15 05:20:28 |
| - | 3276276_MatoSpectoru_tawna_c4_fullcolor_pack_ps_11.json | 18587 | 2025-07-15 05:20:28 |
| - | 3276276_MatoSpectoru_tawna_c4_fullcolor_pack_ps_11.png | 524981 | 2025-07-15 05:20:28 |
| - | 3276277_MatoSpectoru_tawna_c4_fullcolor_pack_ps_17.json | 18587 | 2025-07-15 05:20:28 |
| - | 3276277_MatoSpectoru_tawna_c4_fullcolor_pack_ps_17.png | 580850 | 2025-07-15 05:20:28 |
| - | 3276278_MatoSpectoru_tawna_c4_fullcolor_pack_ps_22.json | 18587 | 2025-07-15 05:20:27 |
| - | 3276278_MatoSpectoru_tawna_c4_fullcolor_pack_ps_22.png | 548539 | 2025-07-15 05:20:27 |
| - | 3276279_MatoSpectoru_tawna_c4_fullcolor_pack_ps_23.json | 18587 | 2025-07-15 05:20:27 |
| - | 3276279_MatoSpectoru_tawna_c4_fullcolor_pack_ps_23.png | 570480 | 2025-07-15 05:20:27 |
| - | 3277422_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_nude_sweat.json | 23508 | 2025-07-15 05:08:47 |
| - | 3277422_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_nude_sweat.png | 544985 | 2025-07-15 05:08:47 |
| - | 3277423_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_nude.json | 23508 | 2025-07-15 05:08:49 |
| - | 3277423_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_nude.png | 538456 | 2025-07-15 05:08:49 |
| - | 3277424_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_nude_penis.json | 23508 | 2025-07-15 05:08:51 |
| - | 3277424_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_nude_penis.png | 572852 | 2025-07-15 05:08:51 |
| - | 3277425_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_suit.json | 23508 | 2025-07-15 05:08:46 |
| - | 3277425_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_suit.png | 517652 | 2025-07-15 05:08:46 |
| - | 3277426_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_suit_penis.json | 23508 | 2025-07-15 05:08:46 |
| - | 3277426_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_suit_penis.png | 552647 | 2025-07-15 05:08:46 |
| - | 3277431_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_suit_chaos.json | 23508 | 2025-07-15 05:08:46 |
| - | 3277431_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_suit_chaos.png | 553433 | 2025-07-15 05:08:46 |
| - | 3277433_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_nude_chaos_a.json | 23508 | 2025-07-15 05:08:51 |
| - | 3277433_MatoSpectoru_amy_rose_amy_jam_2020_fullcolor_ps_nude_chaos_a.png | 573598 | 2025-07-15 05:08:51 |
| - | 3279080_MatoSpectoru_fibell_2020_fullcolor_pack_01_fx.json | 18895 | 2025-07-15 04:52:38 |
| - | 3279080_MatoSpectoru_fibell_2020_fullcolor_pack_01_fx.png | 533873 | 2025-07-15 04:52:38 |
| - | 3279081_MatoSpectoru_fibell_2020_fullcolor_pack_02_fx.json | 18895 | 2025-07-15 04:52:38 |
| - | 3279081_MatoSpectoru_fibell_2020_fullcolor_pack_02_fx.png | 536767 | 2025-07-15 04:52:38 |
| - | 3279082_MatoSpectoru_fibell_2020_fullcolor_pack_04_fx.json | 18895 | 2025-07-15 04:52:38 |
| - | 3279082_MatoSpectoru_fibell_2020_fullcolor_pack_04_fx.png | 521184 | 2025-07-15 04:52:38 |
| - | 3279084_MatoSpectoru_fibell_2020_fullcolor_pack_05_fx.json | 18895 | 2025-07-15 04:52:38 |
| - | 3279084_MatoSpectoru_fibell_2020_fullcolor_pack_05_fx.png | 524216 | 2025-07-15 04:52:38 |
| - | 3279086_MatoSpectoru_fibell_2020_fullcolor_pack_06_fx.json | 18895 | 2025-07-15 04:52:39 |
| - | 3279086_MatoSpectoru_fibell_2020_fullcolor_pack_06_fx.png | 537860 | 2025-07-15 04:52:39 |
| - | 3279935_MatoSpectoru_krystal_comm_fullcolor_pack_01.json | 26022 | 2025-07-15 04:43:16 |
| - | 3279935_MatoSpectoru_krystal_comm_fullcolor_pack_01.png | 885536 | 2025-07-15 04:43:16 |
| - | 3279936_MatoSpectoru_krystal_comm_fullcolor_pack_01_milk.json | 26022 | 2025-07-15 04:43:16 |
| - | 3279936_MatoSpectoru_krystal_comm_fullcolor_pack_01_milk.png | 963987 | 2025-07-15 04:43:16 |
| - | 3279937_MatoSpectoru_krystal_comm_fullcolor_pack_02_milk.json | 26022 | 2025-07-15 04:43:17 |
| - | 3279937_MatoSpectoru_krystal_comm_fullcolor_pack_02_milk.png | 920221 | 2025-07-15 04:43:17 |
| - | 3279938_MatoSpectoru_krystal_comm_fullcolor_pack_03.json | 26022 | 2025-07-15 04:43:16 |
| - | 3279938_MatoSpectoru_krystal_comm_fullcolor_pack_03.png | 882183 | 2025-07-15 04:43:16 |
| - | 3279939_MatoSpectoru_krystal_comm_fullcolor_pack_04.json | 26022 | 2025-07-15 04:43:17 |
| - | 3279939_MatoSpectoru_krystal_comm_fullcolor_pack_04.png | 894598 | 2025-07-15 04:43:17 |
| - | 3279940_MatoSpectoru_krystal_comm_fullcolor_pack_05.json | 26022 | 2025-07-15 04:43:17 |
| - | 3279940_MatoSpectoru_krystal_comm_fullcolor_pack_05.png | 870538 | 2025-07-15 04:43:17 |
| - | 3280181_MatoSpectoru_krystal_comm_fullcolor_pack_01_cum_milk.json | 26022 | 2025-07-15 04:43:17 |
| - | 3280181_MatoSpectoru_krystal_comm_fullcolor_pack_01_cum_milk.png | 962815 | 2025-07-15 04:43:17 |
| - | 3280182_MatoSpectoru_krystal_comm_fullcolor_pack_01_cum.json | 26022 | 2025-07-15 04:43:17 |
| - | 3280182_MatoSpectoru_krystal_comm_fullcolor_pack_01_cum.png | 961912 | 2025-07-15 04:43:17 |
| - | 3288678_MatoSpectoru_toriel_2020_comm_fullcolor_ps_01.json | 20166 | 2025-07-15 03:08:51 |
| - | 3288678_MatoSpectoru_toriel_2020_comm_fullcolor_ps_01.png | 478981 | 2025-07-15 03:08:51 |
| - | 3288683_MatoSpectoru_toriel_2020_comm_fullcolor_ps_07b_bonus.json | 20166 | 2025-07-15 03:08:51 |
| - | 3288683_MatoSpectoru_toriel_2020_comm_fullcolor_ps_07b_bonus.png | 518357 | 2025-07-15 03:08:51 |
| - | 3288686_MatoSpectoru_toriel_2020_comm_fullcolor_ps_07d.json | 20166 | 2025-07-15 03:08:51 |
| - | 3288686_MatoSpectoru_toriel_2020_comm_fullcolor_ps_07d.png | 513100 | 2025-07-15 03:08:51 |
| - | 3288688_MatoSpectoru_toriel_2020_comm_fullcolor_ps_08b.json | 20166 | 2025-07-15 03:08:52 |
| - | 3288688_MatoSpectoru_toriel_2020_comm_fullcolor_ps_08b.png | 497224 | 2025-07-15 03:08:52 |
| - | 3288690_MatoSpectoru_toriel_2020_comm_fullcolor_ps_08c.json | 20166 | 2025-07-15 03:08:52 |
| - | 3288690_MatoSpectoru_toriel_2020_comm_fullcolor_ps_08c.png | 498781 | 2025-07-15 03:08:52 |
| - | 3289863_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_a.json | 21009 | 2025-07-15 02:55:09 |
| - | 3289863_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_a.png | 311931 | 2025-07-15 02:55:09 |
| - | 3289864_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_a1.json | 21009 | 2025-07-15 02:55:09 |
| - | 3289864_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_a1.png | 312697 | 2025-07-15 02:55:09 |
| - | 3289865_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_b.json | 21009 | 2025-07-15 02:55:09 |
| - | 3289865_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_b.png | 315187 | 2025-07-15 02:55:09 |
| - | 3289866_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_b1.json | 21009 | 2025-07-15 02:55:09 |
| - | 3289866_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_b1.png | 318033 | 2025-07-15 02:55:09 |
| - | 3289867_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_c.json | 21009 | 2025-07-15 02:55:09 |
| - | 3289867_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_c.png | 317098 | 2025-07-15 02:55:09 |
| - | 3289868_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_c1.json | 21009 | 2025-07-15 02:55:09 |
| - | 3289868_MatoSpectoru_cream_t_r_winner_poll_ss_fb_sketch_c1.png | 323657 | 2025-07-15 02:55:09 |
| - | 3290953_MatoSpectoru_vanilla_t_r_sept_comm_sketch_fa.json | 15401 | 2025-07-16 08:28:58 |
| - | 3290953_MatoSpectoru_vanilla_t_r_sept_comm_sketch_fa.png | 191943 | 2025-07-16 08:28:58 |
| - | 3290962_MatoSpectoru_vanilla_t_r_sept_comm_sketch_fb.json | 15401 | 2025-07-16 08:28:58 |
| - | 3290962_MatoSpectoru_vanilla_t_r_sept_comm_sketch_fb.png | 190327 | 2025-07-16 08:28:58 |
| - | 3290964_MatoSpectoru_vanilla_t_r_sept_comm_sketch_fc.json | 15401 | 2025-07-16 08:28:58 |
| - | 3290964_MatoSpectoru_vanilla_t_r_sept_comm_sketch_fc.png | 258251 | 2025-07-16 08:28:58 |
| - | 3292014_MatoSpectoru_rouge_t_b_sept_comm_sketch_nude_a_wings.json | 17585 | 2025-07-15 02:35:32 |
| - | 3292014_MatoSpectoru_rouge_t_b_sept_comm_sketch_nude_a_wings.png | 265878 | 2025-07-15 02:35:32 |
| - | 3292015_MatoSpectoru_rouge_t_b_sept_comm_sketch_nude_b1_wings.json | 17585 | 2025-07-15 02:35:32 |
| - | 3292015_MatoSpectoru_rouge_t_b_sept_comm_sketch_nude_b1_wings.png | 279055 | 2025-07-15 02:35:32 |
| - | 3292017_MatoSpectoru_rouge_t_b_sept_comm_sketch_nude_b2_wings.json | 17585 | 2025-07-15 02:35:32 |
| - | 3292017_MatoSpectoru_rouge_t_b_sept_comm_sketch_nude_b2_wings.png | 291806 | 2025-07-15 02:35:32 |
| - | 3292019_MatoSpectoru_rouge_t_b_sept_comm_sketch_nude_a_futa_wings.json | 17585 | 2025-07-15 02:35:32 |
| - | 3292019_MatoSpectoru_rouge_t_b_sept_comm_sketch_nude_a_futa_wings.png | 297151 | 2025-07-15 02:35:32 |
| - | 3293087_MatoSpectoru_amy_rose_sept_comm_sketch_suit_a.json | 21724 | 2025-07-15 02:25:31 |
| - | 3293087_MatoSpectoru_amy_rose_sept_comm_sketch_suit_a.png | 252486 | 2025-07-15 02:25:31 |
| - | 3293091_MatoSpectoru_amy_rose_sept_comm_sketch_suit_b.json | 21724 | 2025-07-15 02:25:31 |
| - | 3293091_MatoSpectoru_amy_rose_sept_comm_sketch_suit_b.png | 255057 | 2025-07-15 02:25:31 |
| - | 3293093_MatoSpectoru_amy_rose_sept_comm_sketch_suit_b2.json | 21724 | 2025-07-15 02:25:31 |
| - | 3293093_MatoSpectoru_amy_rose_sept_comm_sketch_suit_b2.png | 263202 | 2025-07-15 02:25:31 |
| - | 3293096_MatoSpectoru_amy_rose_sept_comm_sketch_c.json | 21724 | 2025-07-15 02:25:32 |
| - | 3293096_MatoSpectoru_amy_rose_sept_comm_sketch_c.png | 278248 | 2025-07-15 02:25:32 |
| - | 3293097_MatoSpectoru_amy_rose_sept_comm_sketch_c2.json | 21724 | 2025-07-15 02:25:32 |
| - | 3293097_MatoSpectoru_amy_rose_sept_comm_sketch_c2.png | 287666 | 2025-07-15 02:25:32 |
| - | 3293098_MatoSpectoru_amy_rose_sept_comm_sketch_c3.json | 21724 | 2025-07-15 02:25:32 |
| - | 3293098_MatoSpectoru_amy_rose_sept_comm_sketch_c3.png | 305780 | 2025-07-15 02:25:32 |
| - | 3305052_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_28_orange.json | 27064 | 2025-07-15 00:33:01 |
| - | 3305052_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_28_orange.png | 577296 | 2025-07-15 00:33:01 |
| - | 3305053_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_31_orange.json | 27064 | 2025-07-15 00:33:02 |
| - | 3305053_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_31_orange.png | 543376 | 2025-07-15 00:33:02 |
| - | 3305056_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_19_orange.json | 27064 | 2025-07-15 00:33:02 |
| - | 3305056_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_19_orange.png | 535484 | 2025-07-15 00:33:02 |
| - | 3305059_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_22_orange.json | 27064 | 2025-07-15 00:33:02 |
| - | 3305059_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_22_orange.png | 592662 | 2025-07-15 00:33:02 |
| - | 3305060_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_10.json | 27064 | 2025-07-15 00:33:02 |
| - | 3305060_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_10.png | 483969 | 2025-07-15 00:33:02 |
| - | 3305062_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_03.json | 27064 | 2025-07-15 00:33:02 |
| - | 3305062_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_03.png | 454511 | 2025-07-15 00:33:02 |
| - | 3305080_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_01.json | 27064 | 2025-07-15 00:33:02 |
| - | 3305080_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_01.png | 503235 | 2025-07-15 00:33:02 |
| - | 3305082_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_02.json | 27064 | 2025-07-15 00:33:02 |
| - | 3305082_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_02.png | 520766 | 2025-07-15 00:33:02 |
| - | 3305341_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_suit_open_bonus.json | 27064 | 2025-07-15 00:33:01 |
| - | 3305341_MatoSpectoru_inkling_girl_comm_fullcolor_pack_ps_woomy_suit_open_bonus.png | 604064 | 2025-07-15 00:33:01 |
| - | 3308924_MatoSpectoru_toriel_surprise_comm_sketch_f1.json | 15724 | 2025-07-16 08:04:32 |
| - | 3308924_MatoSpectoru_toriel_surprise_comm_sketch_f1.png | 206081 | 2025-07-16 08:04:32 |
| - | 3308926_MatoSpectoru_toriel_surprise_comm_sketch_f2.json | 15724 | 2025-07-16 08:04:32 |
| - | 3308926_MatoSpectoru_toriel_surprise_comm_sketch_f2.png | 255161 | 2025-07-16 08:04:32 |
| - | 3308943_MatoSpectoru_toriel_surprise_comm_sketch_f3.json | 15724 | 2025-07-16 08:04:32 |
| - | 3308943_MatoSpectoru_toriel_surprise_comm_sketch_f3.png | 254422 | 2025-07-16 08:04:32 |
| - | 3310406_MatoSpectoru_mina_mongoose_comm_fullcolor_fps_a.json | 10117 | 2025-07-14 23:46:05 |
| - | 3310406_MatoSpectoru_mina_mongoose_comm_fullcolor_fps_a.png | 414865 | 2025-07-14 23:46:05 |
| - | 3314709_MatoSpectoru_insomni_sept_comm_fullcolor_fps1.json | 14775 | 2025-07-14 23:07:54 |
| - | 3314709_MatoSpectoru_insomni_sept_comm_fullcolor_fps1.png | 640384 | 2025-07-14 23:07:54 |
| - | 3314711_MatoSpectoru_insomni_sept_comm_fullcolor_fps2.json | 14775 | 2025-07-14 23:07:55 |
| - | 3314711_MatoSpectoru_insomni_sept_comm_fullcolor_fps2.png | 643836 | 2025-07-14 23:07:55 |
| - | 3314712_MatoSpectoru_insomni_sept_comm_fullcolor_fps2_cum.json | 14775 | 2025-07-14 23:07:55 |
| - | 3314712_MatoSpectoru_insomni_sept_comm_fullcolor_fps2_cum.png | 647086 | 2025-07-14 23:07:55 |
| - | 3314719_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_a1.json | 20700 | 2025-07-14 23:07:49 |
| - | 3314719_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_a1.png | 687667 | 2025-07-14 23:07:49 |
| - | 3314721_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_a2.json | 20700 | 2025-07-14 23:07:49 |
| - | 3314721_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_a2.png | 690766 | 2025-07-14 23:07:49 |
| - | 3314723_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_a3.json | 20700 | 2025-07-14 23:07:50 |
| - | 3314723_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_a3.png | 690430 | 2025-07-14 23:07:50 |
| - | 3314725_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_d1.json | 20700 | 2025-07-14 23:07:50 |
| - | 3314725_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_d1.png | 707059 | 2025-07-14 23:07:50 |
| - | 3314726_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_d2.json | 20700 | 2025-07-14 23:07:50 |
| - | 3314726_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_d2.png | 710009 | 2025-07-14 23:07:50 |
| - | 3314728_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_d3.json | 20700 | 2025-07-14 23:07:50 |
| - | 3314728_MatoSpectoru_blaze_t_c_comm_fullcolor_fps_d3.png | 709683 | 2025-07-14 23:07:50 |
| - | 3328367_MatoSpectoru_alphys_comm_fullcolor_fps_a.json | 15977 | 2025-07-14 21:02:42 |
| - | 3328367_MatoSpectoru_alphys_comm_fullcolor_fps_a.png | 401237 | 2025-07-14 21:02:42 |
| - | 3328370_MatoSpectoru_alphys_comm_fullcolor_fps_a2.json | 15977 | 2025-07-14 21:02:42 |
| - | 3328370_MatoSpectoru_alphys_comm_fullcolor_fps_a2.png | 422741 | 2025-07-14 21:02:42 |
| - | 3328372_MatoSpectoru_alphys_comm_fullcolor_fps_a3.json | 15977 | 2025-07-14 21:02:42 |
| - | 3328372_MatoSpectoru_alphys_comm_fullcolor_fps_a3.png | 440700 | 2025-07-14 21:02:42 |
| - | 3328375_MatoSpectoru_alphys_comm_fullcolor_fps_b.json | 15977 | 2025-07-14 21:02:42 |
| - | 3328375_MatoSpectoru_alphys_comm_fullcolor_fps_b.png | 398000 | 2025-07-14 21:02:42 |
| - | 3367940_MatoSpectoru_mamo_orc_oc_comm_fullcolor_fps.json | 8300 | 2025-07-14 13:30:09 |
| - | 3367940_MatoSpectoru_mamo_orc_oc_comm_fullcolor_fps.png | 648117 | 2025-07-14 13:30:09 |
| - | 3372386_MatoSpectoru_soundbyte_oc_pony_comm_flatcolor_fpsa.json | 12243 | 2025-07-14 12:39:16 |
| - | 3372386_MatoSpectoru_soundbyte_oc_pony_comm_flatcolor_fpsa.png | 377076 | 2025-07-14 12:39:16 |
| - | 3372388_MatoSpectoru_soundbyte_oc_pony_comm_flatcolor_fpsb.json | 12243 | 2025-07-14 12:39:16 |
| - | 3372388_MatoSpectoru_soundbyte_oc_pony_comm_flatcolor_fpsb.png | 390329 | 2025-07-14 12:39:16 |
| - | 3372391_MatoSpectoru_raena_oc_comm_fullcolor_fps.json | 8662 | 2025-07-14 12:39:15 |
| - | 3372391_MatoSpectoru_raena_oc_comm_fullcolor_fps.png | 618147 | 2025-07-14 12:39:15 |
| - | 3372392_MatoSpectoru_dot_anime_fullcolor_fa2.json | 13655 | 2025-07-14 12:39:14 |
| - | 3372392_MatoSpectoru_dot_anime_fullcolor_fa2.png | 577005 | 2025-07-14 12:39:14 |
| - | 3372393_MatoSpectoru_dot_anime_fullcolor_fa.json | 13655 | 2025-07-14 12:39:14 |
| - | 3372393_MatoSpectoru_dot_anime_fullcolor_fa.png | 550034 | 2025-07-14 12:39:14 |
| - | 3372394_MatoSpectoru_dot_anime_fullcolor_fb.json | 13655 | 2025-07-14 12:39:14 |
| - | 3372394_MatoSpectoru_dot_anime_fullcolor_fb.png | 508415 | 2025-07-14 12:39:14 |
| - | 3375894_MatoSpectoru_molly_cunningham_2_comm_fullcolor_f.json | 10068 | 2025-07-14 11:58:59 |
| - | 3375894_MatoSpectoru_molly_cunningham_2_comm_fullcolor_f.png | 655198 | 2025-07-14 11:58:59 |
| - | 3398028_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_01.json | 21944 | 2025-07-14 07:33:09 |
| - | 3398028_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_01.png | 622332 | 2025-07-14 07:33:09 |
| - | 3398032_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_02b.json | 21944 | 2025-07-14 07:33:10 |
| - | 3398032_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_02b.png | 681894 | 2025-07-14 07:33:10 |
| - | 3398034_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_04b.json | 21944 | 2025-07-14 07:33:10 |
| - | 3398034_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_04b.png | 692515 | 2025-07-14 07:33:10 |
| - | 3398036_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_05.json | 21944 | 2025-07-14 07:33:10 |
| - | 3398036_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_05.png | 715372 | 2025-07-14 07:33:10 |
| - | 3398038_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_06b.json | 21944 | 2025-07-14 07:33:10 |
| - | 3398038_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_06b.png | 725331 | 2025-07-14 07:33:10 |
| - | 3398039_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_08b.json | 21944 | 2025-07-14 07:33:10 |
| - | 3398039_MatoSpectoru_megumi_x_audie_comm_fullcolor_fpa_pack_08b.png | 735645 | 2025-07-14 07:33:10 |
| - | 3398071_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_1fps_a.json | 21725 | 2025-07-14 07:32:43 |
| - | 3398071_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_1fps_a.png | 589564 | 2025-07-14 07:32:43 |
| - | 3398072_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_1fps_a_pr.json | 21725 | 2025-07-14 07:32:44 |
| - | 3398072_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_1fps_a_pr.png | 605601 | 2025-07-14 07:32:44 |
| - | 3398075_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_2fps_a.json | 21725 | 2025-07-14 07:32:44 |
| - | 3398075_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_2fps_a.png | 490678 | 2025-07-14 07:32:44 |
| - | 3398076_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_2fps_apr.json | 21725 | 2025-07-14 07:32:44 |
| - | 3398076_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_2fps_apr.png | 522000 | 2025-07-14 07:32:44 |
| - | 3398078_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_2fps_b.json | 21725 | 2025-07-14 07:32:44 |
| - | 3398078_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_2fps_b.png | 509399 | 2025-07-14 07:32:44 |
| - | 3398080_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_2fps_bpr.json | 21725 | 2025-07-14 07:32:46 |
| - | 3398080_MatoSpectoru_penny_fitzgerald_comm_fullcolor_crop_2fps_bpr.png | 541351 | 2025-07-14 07:32:46 |
| - | 3427938_MatoSpectoru_alisa_tanguna_shaymin_oc_character_sheet_comm_flatcolor_fa.json | 13670 | 2025-07-14 02:53:30 |
| - | 3427938_MatoSpectoru_alisa_tanguna_shaymin_oc_character_sheet_comm_flatcolor_fa.png | 584798 | 2025-07-14 02:53:30 |
| - | 3427940_MatoSpectoru_alisa_tanguna_shaymin_oc_character_sheet_comm_flatcolor_fb.json | 13670 | 2025-07-14 02:53:30 |
| - | 3427940_MatoSpectoru_alisa_tanguna_shaymin_oc_character_sheet_comm_flatcolor_fb.png | 523945 | 2025-07-14 02:53:30 |
| - | 3427945_MatoSpectoru_lei_yin_bust_style_comm_fullcolor_pack_ps_01.json | 16678 | 2025-07-14 02:53:26 |
| - | 3427945_MatoSpectoru_lei_yin_bust_style_comm_fullcolor_pack_ps_01.png | 431453 | 2025-07-14 02:53:26 |
| - | 3427947_MatoSpectoru_lei_yin_bust_style_comm_fullcolor_pack_ps_03.json | 16678 | 2025-07-14 02:53:26 |
| - | 3427947_MatoSpectoru_lei_yin_bust_style_comm_fullcolor_pack_ps_03.png | 475721 | 2025-07-14 02:53:26 |
| - | 3427948_MatoSpectoru_lei_yin_bust_style_comm_fullcolor_pack_ps_13.json | 16678 | 2025-07-14 02:53:26 |
| - | 3427948_MatoSpectoru_lei_yin_bust_style_comm_fullcolor_pack_ps_13.png | 474040 | 2025-07-14 02:53:26 |
| - | 3427949_MatoSpectoru_lei_yin_bust_style_comm_fullcolor_pack_ps_14.json | 16678 | 2025-07-14 02:53:27 |
| - | 3427949_MatoSpectoru_lei_yin_bust_style_comm_fullcolor_pack_ps_14.png | 462790 | 2025-07-14 02:53:27 |
| - | 3427951_MatoSpectoru_tersh_girl_comm_fullcolor_f_02.json | 14331 | 2025-07-14 02:53:25 |
| - | 3427951_MatoSpectoru_tersh_girl_comm_fullcolor_f_02.png | 512200 | 2025-07-14 02:53:25 |
| - | 3427952_MatoSpectoru_tersh_girl_comm_fullcolor_f_04.json | 14331 | 2025-07-14 02:53:25 |
| - | 3427952_MatoSpectoru_tersh_girl_comm_fullcolor_f_04.png | 632321 | 2025-07-14 02:53:25 |
| - | 3427953_MatoSpectoru_tersh_girl_comm_fullcolor_f_06.json | 14331 | 2025-07-14 02:53:25 |
| - | 3427953_MatoSpectoru_tersh_girl_comm_fullcolor_f_06.png | 558609 | 2025-07-14 02:53:25 |
| - | 3427956_MatoSpectoru_umbra_oc_xmas_comm_fullcolor_f_ps_a.json | 12152 | 2025-07-14 02:53:23 |
| - | 3427956_MatoSpectoru_umbra_oc_xmas_comm_fullcolor_f_ps_a.png | 738988 | 2025-07-14 02:53:23 |
| - | 3427958_MatoSpectoru_umbra_oc_xmas_comm_fullcolor_f_ps_a2.json | 12152 | 2025-07-14 02:53:23 |
| - | 3427958_MatoSpectoru_umbra_oc_xmas_comm_fullcolor_f_ps_a2.png | 749633 | 2025-07-14 02:53:23 |
| - | 3427961_MatoSpectoru_verona_oc_2020_comm_fullcolor_fps.json | 9103 | 2025-07-14 02:53:22 |
| - | 3427961_MatoSpectoru_verona_oc_2020_comm_fullcolor_fps.png | 655117 | 2025-07-14 02:53:22 |
| - | 3427964_MatoSpectoru_isabella_bandicoot_comm_fullcolor_ps_a.json | 14386 | 2025-07-14 02:53:20 |
| - | 3427964_MatoSpectoru_isabella_bandicoot_comm_fullcolor_ps_a.png | 505862 | 2025-07-14 02:53:20 |
| - | 3427965_MatoSpectoru_isabella_bandicoot_comm_fullcolor_ps_b2.json | 14386 | 2025-07-14 02:53:20 |
| - | 3427965_MatoSpectoru_isabella_bandicoot_comm_fullcolor_ps_b2.png | 538051 | 2025-07-14 02:53:20 |
| - | 3427966_MatoSpectoru_isabella_bandicoot_comm_fullcolor_ps_c.json | 14386 | 2025-07-14 02:53:20 |
| - | 3427966_MatoSpectoru_isabella_bandicoot_comm_fullcolor_ps_c.png | 491816 | 2025-07-14 02:53:20 |
| - | 3427970_MatoSpectoru_mina_mongoose_december_2020_comm_fullcolor_fps.json | 17666 | 2025-07-14 02:53:16 |
| - | 3427970_MatoSpectoru_mina_mongoose_december_2020_comm_fullcolor_fps.png | 585318 | 2025-07-14 02:53:16 |
| - | 3427971_MatoSpectoru_mina_mongoose_december_2020_comm_fullcolor_fps_cum_ass.json | 17666 | 2025-07-14 02:53:17 |
| - | 3427971_MatoSpectoru_mina_mongoose_december_2020_comm_fullcolor_fps_cum_ass.png | 586274 | 2025-07-14 02:53:17 |
| - | 3427972_MatoSpectoru_mina_mongoose_december_2020_comm_fullcolor_fps_cum_pussy.json | 17666 | 2025-07-14 02:53:18 |
| - | 3427972_MatoSpectoru_mina_mongoose_december_2020_comm_fullcolor_fps_cum_pussy.png | 585337 | 2025-07-14 02:53:18 |
| - | 3427975_MatoSpectoru_mina_mongoose_december_2020_comm_fullcolor_fps_cum_both.json | 17666 | 2025-07-14 02:53:18 |
| - | 3427975_MatoSpectoru_mina_mongoose_december_2020_comm_fullcolor_fps_cum_both.png | 586292 | 2025-07-14 02:53:18 |
| - | 3429117_MatoSpectoru_matospectoru_comm_2021_table_inkbunny_lr.json | 22822 | 2025-07-14 02:43:56 |
| - | 3429117_MatoSpectoru_matospectoru_comm_2021_table_inkbunny_lr.png | 1288553 | 2025-07-14 02:43:56 |
| - | 3429118_MatoSpectoru_matospectoru_comm_2021_table_inkbunny_01.json | 22822 | 2025-07-14 02:43:56 |
| - | 3429118_MatoSpectoru_matospectoru_comm_2021_table_inkbunny_01.png | 759369 | 2025-07-14 02:43:56 |
| - | 3429120_MatoSpectoru_matospectoru_comm_2021_table_inkbunny_02.json | 22822 | 2025-07-14 02:43:56 |
| - | 3429120_MatoSpectoru_matospectoru_comm_2021_table_inkbunny_02.png | 214260 | 2025-07-14 02:43:56 |
| - | 3429121_MatoSpectoru_matospectoru_comm_2021_table_inkbunny_04.json | 22822 | 2025-07-14 02:43:56 |
| - | 3429121_MatoSpectoru_matospectoru_comm_2021_table_inkbunny_04.png | 229326 | 2025-07-14 02:43:56 |
| - | 3429122_MatoSpectoru_matospectoru_comm_2021_table_inkbunny_06.json | 22822 | 2025-07-14 02:43:56 |
| - | 3429122_MatoSpectoru_matospectoru_comm_2021_table_inkbunny_06.png | 447925 | 2025-07-14 02:43:56 |
| - | 3438863_MatoSpectoru_erie_cinderace_oc_comm_flatcolor_a.json | 11927 | 2025-07-14 01:19:39 |
| - | 3438863_MatoSpectoru_erie_cinderace_oc_comm_flatcolor_a.png | 436710 | 2025-07-14 01:19:39 |
| - | 3438977_MatoSpectoru_erie_cinderace_oc_comm_flatcolor_b.json | 11927 | 2025-07-14 01:19:39 |
| - | 3438977_MatoSpectoru_erie_cinderace_oc_comm_flatcolor_b.png | 437150 | 2025-07-14 01:19:39 |
| - | 3440553_MatoSpectoru_hiko_espeon_oc_comm_fullcolor_fps2.json | 12005 | 2025-07-14 01:01:35 |
| - | 3440553_MatoSpectoru_hiko_espeon_oc_comm_fullcolor_fps2.png | 586724 | 2025-07-14 01:01:35 |
| - | 3440554_MatoSpectoru_hiko_espeon_oc_comm_fullcolor_fps.json | 12005 | 2025-07-14 01:01:35 |
| - | 3440554_MatoSpectoru_hiko_espeon_oc_comm_fullcolor_fps.png | 591720 | 2025-07-14 01:01:35 |
| - | 3467689_MatoSpectoru_panka_oc_character_sheet_comm_fullcolor_f.json | 15501 | 2025-07-13 21:02:15 |
| - | 3467689_MatoSpectoru_panka_oc_character_sheet_comm_fullcolor_f.png | 901078 | 2025-07-13 21:02:15 |
| - | 3467742_MatoSpectoru_panka_oc_character_sheet_comm_fullcolor_fa.json | 15501 | 2025-07-13 21:02:14 |
| - | 3467742_MatoSpectoru_panka_oc_character_sheet_comm_fullcolor_fa.png | 243371 | 2025-07-13 21:02:14 |
| - | 3467743_MatoSpectoru_panka_oc_character_sheet_comm_fullcolor_fb.json | 15501 | 2025-07-13 21:02:15 |
| - | 3467743_MatoSpectoru_panka_oc_character_sheet_comm_fullcolor_fb.png | 227677 | 2025-07-13 21:02:15 |
| - | 3468957_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_original.json | 21524 | 2025-07-14 18:28:33 |
| - | 3468957_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_original.png | 602130 | 2025-07-14 18:28:33 |
| - | 3468975_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_original_b.json | 21524 | 2025-07-14 18:28:33 |
| - | 3468975_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_original_b.png | 656394 | 2025-07-14 18:28:33 |
| - | 3468980_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_original_b2.json | 21524 | 2025-07-14 18:28:33 |
| - | 3468980_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_original_b2.png | 670753 | 2025-07-14 18:28:33 |
| - | 3468982_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_yellow.json | 21524 | 2025-07-14 18:28:33 |
| - | 3468982_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_yellow.png | 567302 | 2025-07-14 18:28:33 |
| - | 3468986_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_yellow_b.json | 21524 | 2025-07-14 18:28:33 |
| - | 3468986_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_yellow_b.png | 623387 | 2025-07-14 18:28:33 |
| - | 3468988_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_yellow_b2.json | 21524 | 2025-07-14 18:28:34 |
| - | 3468988_MatoSpectoru_delta_the_fire_mewtwo_comm_fullcolor_fps_yellow_b2.png | 634879 | 2025-07-14 18:28:34 |
| - | 3473405_MatoSpectoru_roo_the_goblin_oc_comm_fullcolor_a_fire.json | 15437 | 2025-07-13 20:07:36 |
| - | 3473405_MatoSpectoru_roo_the_goblin_oc_comm_fullcolor_a_fire.png | 542568 | 2025-07-13 20:07:36 |
| - | 3473406_MatoSpectoru_roo_the_goblin_oc_comm_fullcolor_a2_fire.json | 15437 | 2025-07-13 20:07:36 |
| - | 3473406_MatoSpectoru_roo_the_goblin_oc_comm_fullcolor_a2_fire.png | 556010 | 2025-07-13 20:07:36 |
| - | 3473408_MatoSpectoru_roo_the_goblin_oc_comm_fullcolor_b_fire.json | 15437 | 2025-07-13 20:07:37 |
| - | 3473408_MatoSpectoru_roo_the_goblin_oc_comm_fullcolor_b_fire.png | 534755 | 2025-07-13 20:07:37 |
| - | 3473410_MatoSpectoru_roo_the_goblin_oc_comm_fullcolor_b2_fire.json | 15437 | 2025-07-13 20:07:37 |
| - | 3473410_MatoSpectoru_roo_the_goblin_oc_comm_fullcolor_b2_fire.png | 534300 | 2025-07-13 20:07:37 |
| - | 3477827_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_a.json | 20126 | 2025-07-14 18:16:41 |
| - | 3477827_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_a.png | 525175 | 2025-07-14 18:16:41 |
| - | 3477828_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_b.json | 20126 | 2025-07-14 18:16:41 |
| - | 3477828_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_b.png | 604931 | 2025-07-14 18:16:41 |
| - | 3477830_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_a3.json | 20126 | 2025-07-14 18:16:42 |
| - | 3477830_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_a3.png | 531004 | 2025-07-14 18:16:42 |
| - | 3477831_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_b3.json | 20126 | 2025-07-14 18:16:42 |
| - | 3477831_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_b3.png | 610895 | 2025-07-14 18:16:42 |
| - | 3477834_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_c.json | 20126 | 2025-07-14 18:16:42 |
| - | 3477834_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_c.png | 622251 | 2025-07-14 18:16:42 |
| - | 3477835_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_c3.json | 20126 | 2025-07-14 18:16:42 |
| - | 3477835_MatoSpectoru_sharpevoir_oc_comm_fullcolor_f_c3.png | 627061 | 2025-07-14 18:16:42 |
| - | 3478987_MatoSpectoru_cozmo_oc_comm_fullcolor_fb.json | 14083 | 2025-07-13 19:16:37 |
| - | 3478987_MatoSpectoru_cozmo_oc_comm_fullcolor_fb.png | 730345 | 2025-07-13 19:16:37 |
| - | 3478988_MatoSpectoru_cozmo_oc_comm_fullcolor_fc.json | 14083 | 2025-07-13 19:16:37 |
| - | 3478988_MatoSpectoru_cozmo_oc_comm_fullcolor_fc.png | 743677 | 2025-07-13 19:16:37 |
| - | 3478990_MatoSpectoru_cozmo_oc_comm_fullcolor_fa.json | 14083 | 2025-07-13 19:16:37 |
| - | 3478990_MatoSpectoru_cozmo_oc_comm_fullcolor_fa.png | 662408 | 2025-07-13 19:16:37 |
| - | 3490173_MatoSpectoru_rouge_bs_mousepad_crop_f.json | 15331 | 2025-07-13 17:30:40 |
| - | 3490173_MatoSpectoru_rouge_bs_mousepad_crop_f.png | 925666 | 2025-07-13 17:30:40 |
| - | 3490174_MatoSpectoru_rouge_bs_mousepad_f_lr.json | 15331 | 2025-07-13 17:30:41 |
| - | 3490174_MatoSpectoru_rouge_bs_mousepad_f_lr.png | 731934 | 2025-07-13 17:30:41 |
| - | 3490185_MatoSpectoru_rouge_bs_mousepad_f_no_text_lr.json | 15331 | 2025-07-13 17:30:41 |
| - | 3490185_MatoSpectoru_rouge_bs_mousepad_f_no_text_lr.png | 719579 | 2025-07-13 17:30:41 |
| - | 3496837_MatoSpectoru_mackenzie_wright_oc_comm_fullcolor_fps_a2.json | 15401 | 2025-07-13 16:13:49 |
| - | 3496837_MatoSpectoru_mackenzie_wright_oc_comm_fullcolor_fps_a2.png | 577893 | 2025-07-13 16:13:49 |
| - | 3496909_MatoSpectoru_mackenzie_wright_oc_comm_fullcolor_fps_a.json | 15401 | 2025-07-13 16:13:49 |
| - | 3496909_MatoSpectoru_mackenzie_wright_oc_comm_fullcolor_fps_a.png | 568447 | 2025-07-13 16:13:49 |
| - | 3496919_MatoSpectoru_mackenzie_wright_oc_comm_fullcolor_fps_b2.json | 15401 | 2025-07-13 16:13:49 |
| - | 3496919_MatoSpectoru_mackenzie_wright_oc_comm_fullcolor_fps_b2.png | 612301 | 2025-07-13 16:13:49 |
| - | 3496920_MatoSpectoru_mackenzie_wright_oc_comm_fullcolor_fps_b.json | 15401 | 2025-07-13 16:13:49 |
| - | 3496920_MatoSpectoru_mackenzie_wright_oc_comm_fullcolor_fps_b.png | 602805 | 2025-07-13 16:13:49 |
| - | 3501150_MatoSpectoru_asayi_oc_comm_flatcolor_ps_a.json | 12253 | 2025-07-13 15:30:56 |
| - | 3501150_MatoSpectoru_asayi_oc_comm_flatcolor_ps_a.png | 376120 | 2025-07-13 15:30:56 |
| - | 3501151_MatoSpectoru_asayi_oc_comm_flatcolor_ps_b.json | 12253 | 2025-07-13 15:30:56 |
| - | 3501151_MatoSpectoru_asayi_oc_comm_flatcolor_ps_b.png | 383907 | 2025-07-13 15:30:56 |
| - | 3502692_MatoSpectoru_cherri_hazbin_hotel_comm_fullcolor_fpsa2.json | 12292 | 2025-07-13 15:15:56 |
| - | 3502692_MatoSpectoru_cherri_hazbin_hotel_comm_fullcolor_fpsa2.png | 689221 | 2025-07-13 15:15:56 |
| - | 3502693_MatoSpectoru_cherri_hazbin_hotel_comm_fullcolor_fpsb.json | 12292 | 2025-07-13 15:15:56 |
| - | 3502693_MatoSpectoru_cherri_hazbin_hotel_comm_fullcolor_fpsb.png | 680222 | 2025-07-13 15:15:56 |
| - | 3502694_MatoSpectoru_hariet_sfp_a.json | 16446 | 2025-07-13 15:15:55 |
| - | 3502694_MatoSpectoru_hariet_sfp_a.png | 483282 | 2025-07-13 15:15:55 |
| - | 3502695_MatoSpectoru_hariet_sfp_a2.json | 16446 | 2025-07-13 15:15:55 |
| - | 3502695_MatoSpectoru_hariet_sfp_a2.png | 501900 | 2025-07-13 15:15:55 |
| - | 3502696_MatoSpectoru_hariet_sfp_b.json | 16446 | 2025-07-13 15:15:55 |
| - | 3502696_MatoSpectoru_hariet_sfp_b.png | 397000 | 2025-07-13 15:15:55 |
| - | 3502697_MatoSpectoru_hariet_sfp_b2.json | 16446 | 2025-07-13 15:15:55 |
| - | 3502697_MatoSpectoru_hariet_sfp_b2.png | 420116 | 2025-07-13 15:15:55 |
| - | 3533899_MatoSpectoru_flora_chao_oc_comm_fullcolor_fb.json | 24484 | 2025-07-13 17:36:56 |
| - | 3533899_MatoSpectoru_flora_chao_oc_comm_fullcolor_fb.png | 466488 | 2025-07-13 17:36:56 |
| - | 3533999_MatoSpectoru_flora_chao_oc_comm_fullcolor_fb_cum.json | 24484 | 2025-07-13 17:36:56 |
| - | 3533999_MatoSpectoru_flora_chao_oc_comm_fullcolor_fb_cum.png | 474311 | 2025-07-13 17:36:56 |
| - | 3534016_MatoSpectoru_flora_chao_oc_comm_fullcolor_fb_milk.json | 24484 | 2025-07-13 17:36:57 |
| - | 3534016_MatoSpectoru_flora_chao_oc_comm_fullcolor_fb_milk.png | 487229 | 2025-07-13 17:36:57 |
| - | 3534018_MatoSpectoru_flora_chao_oc_comm_fullcolor_fb_mix.json | 24484 | 2025-07-13 17:36:57 |
| - | 3534018_MatoSpectoru_flora_chao_oc_comm_fullcolor_fb_mix.png | 494621 | 2025-07-13 17:36:57 |
| - | 3534020_MatoSpectoru_flora_chao_oc_comm_fullcolor_fa.json | 24484 | 2025-07-13 17:36:57 |
| - | 3534020_MatoSpectoru_flora_chao_oc_comm_fullcolor_fa.png | 675575 | 2025-07-13 17:36:57 |
| - | 3534025_MatoSpectoru_flora_chao_oc_comm_fullcolor_fa_cum.json | 24484 | 2025-07-13 17:36:57 |
| - | 3534025_MatoSpectoru_flora_chao_oc_comm_fullcolor_fa_cum.png | 680828 | 2025-07-13 17:36:57 |
| - | 3534029_MatoSpectoru_flora_chao_oc_comm_fullcolor_fa_milk.json | 24484 | 2025-07-13 17:36:57 |
| - | 3534029_MatoSpectoru_flora_chao_oc_comm_fullcolor_fa_milk.png | 698515 | 2025-07-13 17:36:57 |
| - | 3534030_MatoSpectoru_flora_chao_oc_comm_fullcolor_fa_mix.json | 24484 | 2025-07-13 17:36:58 |
| - | 3534030_MatoSpectoru_flora_chao_oc_comm_fullcolor_fa_mix.png | 703398 | 2025-07-13 17:36:58 |
| - | 3538830_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_a.json | 20699 | 2025-07-13 09:13:11 |
| - | 3538830_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_a.png | 729249 | 2025-07-13 09:13:11 |
| - | 3538831_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_a2.json | 20699 | 2025-07-13 09:13:11 |
| - | 3538831_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_a2.png | 703001 | 2025-07-13 09:13:11 |
| - | 3538834_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_a2_piercing.json | 20699 | 2025-07-13 09:13:12 |
| - | 3538834_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_a2_piercing.png | 704941 | 2025-07-13 09:13:12 |
| - | 3538836_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_a_piercing.json | 20699 | 2025-07-13 09:13:12 |
| - | 3538836_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_a_piercing.png | 731266 | 2025-07-13 09:13:12 |
| - | 3538837_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_b.json | 20699 | 2025-07-13 09:13:12 |
| - | 3538837_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_b.png | 956303 | 2025-07-13 09:13:12 |
| - | 3538838_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_b_piercing.json | 20699 | 2025-07-13 09:13:12 |
| - | 3538838_MatoSpectoru_blaziken_2021_comm_fullcolor_fps_b_piercing.png | 959370 | 2025-07-13 09:13:12 |
| - | 3542753_MatoSpectoru_sophie_sylveon_oc_comm_fullcolor_fps1b.json | 13040 | 2025-07-13 08:41:33 |
| - | 3542753_MatoSpectoru_sophie_sylveon_oc_comm_fullcolor_fps1b.png | 576270 | 2025-07-13 08:41:33 |
| - | 3542807_MatoSpectoru_sophie_sylveon_oc_comm_fullcolor_fps2b.json | 13040 | 2025-07-13 08:41:34 |
| - | 3542807_MatoSpectoru_sophie_sylveon_oc_comm_fullcolor_fps2b.png | 663006 | 2025-07-13 08:41:34 |
| - | 3543884_MatoSpectoru_alice_renimpmon_oc_comm_fullcolor_fpsa.json | 12825 | 2025-07-13 08:32:34 |
| - | 3543884_MatoSpectoru_alice_renimpmon_oc_comm_fullcolor_fpsa.png | 657029 | 2025-07-13 08:32:34 |
| - | 3543886_MatoSpectoru_alice_renimpmon_oc_comm_fullcolor_fpsb.json | 12825 | 2025-07-13 08:32:35 |
| - | 3543886_MatoSpectoru_alice_renimpmon_oc_comm_fullcolor_fpsb.png | 617841 | 2025-07-13 08:32:35 |
| - | 3545150_MatoSpectoru_cain_comm_fullcolor_fps_a.json | 13276 | 2025-07-13 08:22:03 |
| - | 3545150_MatoSpectoru_cain_comm_fullcolor_fps_a.png | 648923 | 2025-07-13 08:22:03 |
| - | 3545151_MatoSpectoru_cain_comm_fullcolor_fps_b.json | 13276 | 2025-07-13 08:22:03 |
| - | 3545151_MatoSpectoru_cain_comm_fullcolor_fps_b.png | 657497 | 2025-07-13 08:22:03 |
| - | 3545153_MatoSpectoru_cain_comm_fullcolor_fps_c.json | 13276 | 2025-07-13 08:22:03 |
| - | 3545153_MatoSpectoru_cain_comm_fullcolor_fps_c.png | 658518 | 2025-07-13 08:22:03 |
| - | 3546118_MatoSpectoru_charlotte_fall_oc_comm_fullcolor_nude_a.json | 17063 | 2025-07-13 08:13:32 |
| - | 3546118_MatoSpectoru_charlotte_fall_oc_comm_fullcolor_nude_a.png | 576910 | 2025-07-13 08:13:32 |
| - | 3546121_MatoSpectoru_charlotte_fall_oc_comm_fullcolor_nude_a2.json | 17063 | 2025-07-13 08:13:33 |
| - | 3546121_MatoSpectoru_charlotte_fall_oc_comm_fullcolor_nude_a2.png | 648452 | 2025-07-13 08:13:33 |
| - | 3546124_MatoSpectoru_charlotte_fall_oc_comm_fullcolor_nude_b.json | 17063 | 2025-07-13 08:13:34 |
| - | 3546124_MatoSpectoru_charlotte_fall_oc_comm_fullcolor_nude_b.png | 647001 | 2025-07-13 08:13:34 |
| - | 3546125_MatoSpectoru_charlotte_fall_oc_comm_fullcolor_nude_b_cum.json | 17063 | 2025-07-13 08:13:34 |
| - | 3546125_MatoSpectoru_charlotte_fall_oc_comm_fullcolor_nude_b_cum.png | 656202 | 2025-07-13 08:13:34 |
| - | 3550746_MatoSpectoru_katie_x_aris_oc_comm_fullcolor_f_a.json | 17065 | 2025-07-13 07:34:10 |
| - | 3550746_MatoSpectoru_katie_x_aris_oc_comm_fullcolor_f_a.png | 638481 | 2025-07-13 07:34:10 |
| - | 3550748_MatoSpectoru_katie_x_aris_oc_comm_fullcolor_f_a2.json | 17065 | 2025-07-13 07:34:09 |
| - | 3550748_MatoSpectoru_katie_x_aris_oc_comm_fullcolor_f_a2.png | 712281 | 2025-07-13 07:34:09 |
| - | 3550751_MatoSpectoru_katie_x_aris_oc_comm_fullcolor_f_b.json | 17065 | 2025-07-13 07:34:10 |
| - | 3550751_MatoSpectoru_katie_x_aris_oc_comm_fullcolor_f_b.png | 683950 | 2025-07-13 07:34:10 |
| - | 3550753_MatoSpectoru_katie_x_aris_oc_comm_fullcolor_f_b2.json | 17065 | 2025-07-13 07:34:12 |
| - | 3550753_MatoSpectoru_katie_x_aris_oc_comm_fullcolor_f_b2.png | 756282 | 2025-07-13 07:34:12 |
| - | 3551795_MatoSpectoru_buffy-sugo_comm_fullcolor_f_a.json | 18440 | 2025-07-13 07:25:16 |
| - | 3551795_MatoSpectoru_buffy-sugo_comm_fullcolor_f_a.png | 698410 | 2025-07-13 07:25:16 |
| - | 3551796_MatoSpectoru_buffy-sugo_comm_fullcolor_f_b.json | 18440 | 2025-07-13 07:25:16 |
| - | 3551796_MatoSpectoru_buffy-sugo_comm_fullcolor_f_b.png | 728410 | 2025-07-13 07:25:16 |
| - | 3551797_MatoSpectoru_buffy-sugo_comm_fullcolor_f_b2.json | 18440 | 2025-07-13 07:25:17 |
| - | 3551797_MatoSpectoru_buffy-sugo_comm_fullcolor_f_b2.png | 728044 | 2025-07-13 07:25:17 |
| - | 3551798_MatoSpectoru_buffy-sugo_comm_fullcolor_f_b3.json | 18440 | 2025-07-13 07:25:17 |
| - | 3551798_MatoSpectoru_buffy-sugo_comm_fullcolor_f_b3.png | 674057 | 2025-07-13 07:25:17 |
| - | 3551799_MatoSpectoru_buffy-sugo_comm_fullcolor_f_c2.json | 18440 | 2025-07-13 07:25:16 |
| - | 3551799_MatoSpectoru_buffy-sugo_comm_fullcolor_f_c2.png | 729570 | 2025-07-13 07:25:16 |
| - | 3589020_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a.json | 25365 | 2025-07-13 02:11:45 |
| - | 3589020_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a.png | 855131 | 2025-07-13 02:11:45 |
| - | 3589021_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a2.json | 25365 | 2025-07-13 02:11:44 |
| - | 3589021_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a2.png | 1020253 | 2025-07-13 02:11:44 |
| - | 3589022_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a3.json | 25365 | 2025-07-13 02:11:44 |
| - | 3589022_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a3.png | 1033914 | 2025-07-13 02:11:44 |
| - | 3589023_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a4.json | 25365 | 2025-07-13 02:11:45 |
| - | 3589023_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a4.png | 947200 | 2025-07-13 02:11:45 |
| - | 3589024_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a5.json | 25365 | 2025-07-13 02:11:45 |
| - | 3589024_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a5.png | 921816 | 2025-07-13 02:11:45 |
| - | 3589025_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a5b.json | 25365 | 2025-07-13 02:11:44 |
| - | 3589025_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a5b.png | 923825 | 2025-07-13 02:11:44 |
| - | 3589026_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a6.json | 25365 | 2025-07-13 02:11:45 |
| - | 3589026_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a6.png | 935112 | 2025-07-13 02:11:45 |
| - | 3589028_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a6b.json | 25365 | 2025-07-13 02:11:44 |
| - | 3589028_MatoSpectoru_coco_x_coal_oc_comm_fullcolor_ps_a6b.png | 936096 | 2025-07-13 02:11:44 |
| - | 3591259_MatoSpectoru_sunny_d_light_oc_comm_fullcolor_fps_a2.json | 11848 | 2025-07-13 01:53:59 |
| - | 3591259_MatoSpectoru_sunny_d_light_oc_comm_fullcolor_fps_a2.png | 610490 | 2025-07-13 01:53:59 |
| - | 3591261_MatoSpectoru_sunny_d_light_oc_comm_fullcolor_fps_a.json | 11848 | 2025-07-13 01:54:00 |
| - | 3591261_MatoSpectoru_sunny_d_light_oc_comm_fullcolor_fps_a.png | 599988 | 2025-07-13 01:54:00 |
| - | 3592802_MatoSpectoru_peridot_dakimakura_front_comm_fullcolor_ps_a_crop.json | 17301 | 2025-07-13 01:41:27 |
| - | 3592802_MatoSpectoru_peridot_dakimakura_front_comm_fullcolor_ps_a_crop.png | 1467250 | 2025-07-13 01:41:27 |
| - | 3592878_MatoSpectoru_peridot_dakimakura_front_comm_fullcolor_ps_a2_crop.json | 17301 | 2025-07-13 01:41:27 |
| - | 3592878_MatoSpectoru_peridot_dakimakura_front_comm_fullcolor_ps_a2_crop.png | 1479998 | 2025-07-13 01:41:27 |
| - | 3593083_MatoSpectoru_peridot_dakimakura_front_comm_fullcolor_ps_b_crop.json | 17301 | 2025-07-13 01:41:27 |
| - | 3593083_MatoSpectoru_peridot_dakimakura_front_comm_fullcolor_ps_b_crop.png | 1560268 | 2025-07-13 01:41:27 |
| - | 3593084_MatoSpectoru_peridot_dakimakura_front_comm_fullcolor_ps_b2_crop.json | 17301 | 2025-07-13 01:41:28 |
| - | 3593084_MatoSpectoru_peridot_dakimakura_front_comm_fullcolor_ps_b2_crop.png | 1561753 | 2025-07-13 01:41:28 |
| - | 3594126_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_01.json | 32727 | 2025-07-13 15:16:20 |
| - | 3594126_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_01.png | 540945 | 2025-07-13 15:16:20 |
| - | 3594127_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_02.json | 32727 | 2025-07-13 15:16:20 |
| - | 3594127_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_02.png | 546102 | 2025-07-13 15:16:20 |
| - | 3594128_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_03.json | 32727 | 2025-07-13 15:16:20 |
| - | 3594128_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_03.png | 523813 | 2025-07-13 15:16:20 |
| - | 3594129_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_04.json | 32727 | 2025-07-13 15:16:21 |
| - | 3594129_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_04.png | 544997 | 2025-07-13 15:16:21 |
| - | 3594130_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_05.json | 32727 | 2025-07-13 15:16:21 |
| - | 3594130_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_05.png | 551647 | 2025-07-13 15:16:21 |
| - | 3594131_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_06.json | 32727 | 2025-07-13 15:16:21 |
| - | 3594131_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_06.png | 555699 | 2025-07-13 15:16:21 |
| - | 3594132_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_07.json | 32727 | 2025-07-13 15:16:22 |
| - | 3594132_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_07.png | 560862 | 2025-07-13 15:16:22 |
| - | 3594133_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_08.json | 32727 | 2025-07-13 15:16:22 |
| - | 3594133_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_08.png | 585929 | 2025-07-13 15:16:22 |
| - | 3594134_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_09.json | 32727 | 2025-07-13 15:16:22 |
| - | 3594134_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_09.png | 561196 | 2025-07-13 15:16:22 |
| - | 3594135_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_11.json | 32727 | 2025-07-13 15:16:22 |
| - | 3594135_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_11.png | 560281 | 2025-07-13 15:16:22 |
| - | 3594136_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_13.json | 32727 | 2025-07-13 15:16:22 |
| - | 3594136_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_13.png | 597526 | 2025-07-13 15:16:22 |
| - | 3594138_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_15.json | 32727 | 2025-07-13 15:16:23 |
| - | 3594138_MatoSpectoru_cream_t_r_comm_fullcolor_fa_ps_15.png | 622365 | 2025-07-13 15:16:23 |
| - | 3611647_MatoSpectoru_nebula_shortstack_oc_comm_fullcolor_fps_01.json | 16208 | 2025-07-12 23:03:43 |
| - | 3611647_MatoSpectoru_nebula_shortstack_oc_comm_fullcolor_fps_01.png | 933477 | 2025-07-12 23:03:43 |
| - | 3611648_MatoSpectoru_nebula_shortstack_oc_comm_fullcolor_fps_02.json | 16208 | 2025-07-12 23:03:43 |
| - | 3611648_MatoSpectoru_nebula_shortstack_oc_comm_fullcolor_fps_02.png | 942934 | 2025-07-12 23:03:43 |
| - | 3611649_MatoSpectoru_nebula_shortstack_oc_comm_fullcolor_fps_04.json | 16208 | 2025-07-12 23:03:44 |
| - | 3611649_MatoSpectoru_nebula_shortstack_oc_comm_fullcolor_fps_04.png | 959410 | 2025-07-12 23:03:44 |
| - | 3611653_MatoSpectoru_nebula_shortstack_oc_comm_fullcolor_fps_05.json | 16208 | 2025-07-12 23:03:44 |
| - | 3611653_MatoSpectoru_nebula_shortstack_oc_comm_fullcolor_fps_05.png | 960505 | 2025-07-12 23:03:44 |
| - | 3620006_MatoSpectoru_felicia_oc_fullcolor_ps_01.json | 19582 | 2025-07-12 21:38:25 |
| - | 3620006_MatoSpectoru_felicia_oc_fullcolor_ps_01.png | 333923 | 2025-07-12 21:38:25 |
| - | 3620007_MatoSpectoru_felicia_oc_fullcolor_ps_01_hat.json | 19582 | 2025-07-12 21:38:25 |
| - | 3620007_MatoSpectoru_felicia_oc_fullcolor_ps_01_hat.png | 381806 | 2025-07-12 21:38:25 |
| - | 3620008_MatoSpectoru_felicia_oc_fullcolor_ps_02.json | 19582 | 2025-07-12 21:38:26 |
| - | 3620008_MatoSpectoru_felicia_oc_fullcolor_ps_02.png | 378632 | 2025-07-12 21:38:26 |
| - | 3620010_MatoSpectoru_felicia_oc_fullcolor_ps_02_hat.json | 19582 | 2025-07-12 21:38:26 |
| - | 3620010_MatoSpectoru_felicia_oc_fullcolor_ps_02_hat.png | 432063 | 2025-07-12 21:38:26 |
| - | 3620011_MatoSpectoru_felicia_oc_fullcolor_ps_03.json | 19582 | 2025-07-12 21:38:26 |
| - | 3620011_MatoSpectoru_felicia_oc_fullcolor_ps_03.png | 424951 | 2025-07-12 21:38:26 |
| - | 3620012_MatoSpectoru_felicia_oc_fullcolor_ps_03_hat.json | 19582 | 2025-07-12 21:38:26 |
| - | 3620012_MatoSpectoru_felicia_oc_fullcolor_ps_03_hat.png | 484167 | 2025-07-12 21:38:26 |
| - | 3625381_MatoSpectoru_pepper_oc_comm_fullcolor_f_psf1.json | 9631 | 2025-07-12 20:46:49 |
| - | 3625381_MatoSpectoru_pepper_oc_comm_fullcolor_f_psf1.png | 575123 | 2025-07-12 20:46:49 |
| - | 3635535_MatoSpectoru_midna_milk_comm_fullcolor_ps_b.json | 19459 | 2025-07-12 19:12:35 |
| - | 3635535_MatoSpectoru_midna_milk_comm_fullcolor_ps_b.png | 742102 | 2025-07-12 19:12:35 |
| - | 3635536_MatoSpectoru_midna_milk_comm_fullcolor_ps_b2.json | 19459 | 2025-07-12 19:12:35 |
| - | 3635536_MatoSpectoru_midna_milk_comm_fullcolor_ps_b2.png | 765058 | 2025-07-12 19:12:35 |
| - | 3635539_MatoSpectoru_midna_milk_comm_fullcolor_ps_inverted_nippples_a2.json | 19459 | 2025-07-12 19:12:35 |
| - | 3635539_MatoSpectoru_midna_milk_comm_fullcolor_ps_inverted_nippples_a2.png | 756581 | 2025-07-12 19:12:35 |
| - | 3635540_MatoSpectoru_midna_milk_comm_fullcolor_ps_b3.json | 19459 | 2025-07-12 19:12:35 |
| - | 3635540_MatoSpectoru_midna_milk_comm_fullcolor_ps_b3.png | 766528 | 2025-07-12 19:12:35 |
| - | 3635542_MatoSpectoru_midna_milk_comm_fullcolor_ps_b3_pr.json | 19459 | 2025-07-12 19:12:36 |
| - | 3635542_MatoSpectoru_midna_milk_comm_fullcolor_ps_b3_pr.png | 780636 | 2025-07-12 19:12:36 |
| - | 3637498_MatoSpectoru_tsukino_mh_fullcolor_ff_1.json | 18458 | 2025-07-12 18:56:41 |
| - | 3637498_MatoSpectoru_tsukino_mh_fullcolor_ff_1.png | 474659 | 2025-07-12 18:56:41 |
| - | 3637499_MatoSpectoru_tsukino_mh_fullcolor_ff_2.json | 18458 | 2025-07-12 18:56:41 |
| - | 3637499_MatoSpectoru_tsukino_mh_fullcolor_ff_2.png | 486897 | 2025-07-12 18:56:41 |
| - | 3637500_MatoSpectoru_tsukino_mh_fullcolor_ff_3.json | 18458 | 2025-07-12 18:56:41 |
| - | 3637500_MatoSpectoru_tsukino_mh_fullcolor_ff_3.png | 510253 | 2025-07-12 18:56:41 |
| - | 3637501_MatoSpectoru_tsukino_mh_fullcolor_ff_4.json | 18458 | 2025-07-12 18:56:42 |
| - | 3637501_MatoSpectoru_tsukino_mh_fullcolor_ff_4.png | 528368 | 2025-07-12 18:56:42 |
| - | 3637503_MatoSpectoru_tsukino_mh_fullcolor_ff_5.json | 18458 | 2025-07-12 18:56:42 |
| - | 3637503_MatoSpectoru_tsukino_mh_fullcolor_ff_5.png | 443680 | 2025-07-12 18:56:42 |
| - | 3637507_MatoSpectoru_erie_cinderace_x_horse_comm_fullcolor_ps_01.json | 19611 | 2025-07-12 18:56:38 |
| - | 3637507_MatoSpectoru_erie_cinderace_x_horse_comm_fullcolor_ps_01.png | 669722 | 2025-07-12 18:56:38 |
| - | 3637509_MatoSpectoru_erie_cinderace_x_horse_comm_fullcolor_ps_06.json | 19611 | 2025-07-12 18:56:38 |
| - | 3637509_MatoSpectoru_erie_cinderace_x_horse_comm_fullcolor_ps_06.png | 744380 | 2025-07-12 18:56:38 |
| - | 3637510_MatoSpectoru_erie_cinderace_x_horse_comm_fullcolor_ps_07.json | 19611 | 2025-07-12 18:56:38 |
| - | 3637510_MatoSpectoru_erie_cinderace_x_horse_comm_fullcolor_ps_07.png | 745543 | 2025-07-12 18:56:38 |
| - | 3637513_MatoSpectoru_erie_cinderace_x_horse_comm_fullcolor_ps_08.json | 19611 | 2025-07-12 18:56:38 |
| - | 3637513_MatoSpectoru_erie_cinderace_x_horse_comm_fullcolor_ps_08.png | 660386 | 2025-07-12 18:56:38 |
| - | 3637516_MatoSpectoru_erie_cinderace_x_horse_comm_fullcolor_ps_09.json | 19611 | 2025-07-12 18:56:39 |
| - | 3637516_MatoSpectoru_erie_cinderace_x_horse_comm_fullcolor_ps_09.png | 661828 | 2025-07-12 18:56:39 |
| - | 3654376_MatoSpectoru_ruby_gardevoir_comm_fullcolor_fpsa2.json | 12155 | 2025-07-12 16:23:50 |
| - | 3654376_MatoSpectoru_ruby_gardevoir_comm_fullcolor_fpsa2.png | 483501 | 2025-07-12 16:23:50 |
| - | 3654377_MatoSpectoru_ruby_gardevoir_comm_fullcolor_fpsb2.json | 12155 | 2025-07-12 16:23:50 |
| - | 3654377_MatoSpectoru_ruby_gardevoir_comm_fullcolor_fpsb2.png | 484680 | 2025-07-12 16:23:50 |
| - | 3711132_MatoSpectoru_akeno_bee_comm_fullcolor_fps_a.json | 12672 | 2025-07-12 06:44:05 |
| - | 3711132_MatoSpectoru_akeno_bee_comm_fullcolor_fps_a.png | 892382 | 2025-07-12 06:44:05 |
| - | 3711137_MatoSpectoru_akeno_bee_comm_fullcolor_fps_a2.json | 12672 | 2025-07-12 06:44:05 |
| - | 3711137_MatoSpectoru_akeno_bee_comm_fullcolor_fps_a2.png | 888566 | 2025-07-12 06:44:05 |
| - | 3711141_MatoSpectoru_rouge_jackochallenge_fullcolor_ps_suit_a_big.json | 20560 | 2025-07-12 06:43:53 |
| - | 3711141_MatoSpectoru_rouge_jackochallenge_fullcolor_ps_suit_a_big.png | 1305799 | 2025-07-12 06:43:53 |
| - | 3711145_MatoSpectoru_rouge_jackochallenge_fullcolor_ps_suit_a2_big.json | 20560 | 2025-07-12 06:43:54 |
| - | 3711145_MatoSpectoru_rouge_jackochallenge_fullcolor_ps_suit_a2_big.png | 1376841 | 2025-07-12 06:43:54 |
| - | 3711146_MatoSpectoru_rouge_jackochallenge_fullcolor_ps_suit_a3_big.json | 20560 | 2025-07-12 06:43:54 |
| - | 3711146_MatoSpectoru_rouge_jackochallenge_fullcolor_ps_suit_a3_big.png | 1427167 | 2025-07-12 06:43:54 |
| - | 3711150_MatoSpectoru_rouge_jackochallenge_fullcolor_ps_nude_big.json | 20560 | 2025-07-12 06:43:54 |
| - | 3711150_MatoSpectoru_rouge_jackochallenge_fullcolor_ps_nude_big.png | 1331042 | 2025-07-12 06:43:54 |
| - | 3711152_MatoSpectoru_rouge_jackochallenge_fullcolor_ps_ar_big.json | 20560 | 2025-07-12 06:43:55 |
| - | 3711152_MatoSpectoru_rouge_jackochallenge_fullcolor_ps_ar_big.png | 1407821 | 2025-07-12 06:43:55 |
| - | 3717863_MatoSpectoru_judy_hopps_comm_fullcolor_ps_farmer.json | 33654 | 2025-07-12 05:27:13 |
| - | 3717863_MatoSpectoru_judy_hopps_comm_fullcolor_ps_farmer.png | 703528 | 2025-07-12 05:27:13 |
| - | 3717864_MatoSpectoru_judy_hopps_comm_fullcolor_ps_farmer_penis.json | 33654 | 2025-07-12 05:27:13 |
| - | 3717864_MatoSpectoru_judy_hopps_comm_fullcolor_ps_farmer_penis.png | 738579 | 2025-07-12 05:27:13 |
| - | 3717865_MatoSpectoru_judy_hopps_comm_fullcolor_ps_farmer_penis_cum.json | 33654 | 2025-07-12 05:27:13 |
| - | 3717865_MatoSpectoru_judy_hopps_comm_fullcolor_ps_farmer_penis_cum.png | 746755 | 2025-07-12 05:27:13 |
| - | 3717866_MatoSpectoru_judy_hopps_comm_fullcolor_ps_farmer_pr.json | 33654 | 2025-07-12 05:27:12 |
| - | 3717866_MatoSpectoru_judy_hopps_comm_fullcolor_ps_farmer_pr.png | 796214 | 2025-07-12 05:27:12 |
| - | 3717867_MatoSpectoru_judy_hopps_comm_fullcolor_ps_nude.json | 33654 | 2025-07-12 05:27:12 |
| - | 3717867_MatoSpectoru_judy_hopps_comm_fullcolor_ps_nude.png | 632046 | 2025-07-12 05:27:12 |
| - | 3717868_MatoSpectoru_judy_hopps_comm_fullcolor_ps_nude_penis.json | 33654 | 2025-07-12 05:27:12 |
| - | 3717868_MatoSpectoru_judy_hopps_comm_fullcolor_ps_nude_penis.png | 668098 | 2025-07-12 05:27:12 |
| - | 3717869_MatoSpectoru_judy_hopps_comm_fullcolor_ps_nude_penis_cum.json | 33654 | 2025-07-12 05:27:12 |
| - | 3717869_MatoSpectoru_judy_hopps_comm_fullcolor_ps_nude_penis_cum.png | 677050 | 2025-07-12 05:27:12 |
| - | 3717870_MatoSpectoru_judy_hopps_comm_fullcolor_ps_nude_pr.json | 33654 | 2025-07-12 05:27:12 |
| - | 3717870_MatoSpectoru_judy_hopps_comm_fullcolor_ps_nude_pr.png | 722576 | 2025-07-12 05:27:12 |
| - | 3717871_MatoSpectoru_judy_hopps_comm_fullcolor_ps_suit.json | 33654 | 2025-07-12 05:27:11 |
| - | 3717871_MatoSpectoru_judy_hopps_comm_fullcolor_ps_suit.png | 588403 | 2025-07-12 05:27:11 |
| - | 3717872_MatoSpectoru_judy_hopps_comm_fullcolor_ps_suit_penis.json | 33654 | 2025-07-12 05:27:11 |
| - | 3717872_MatoSpectoru_judy_hopps_comm_fullcolor_ps_suit_penis.png | 624808 | 2025-07-12 05:27:11 |
| - | 3717873_MatoSpectoru_judy_hopps_comm_fullcolor_ps_suit_penis_cum.json | 33654 | 2025-07-12 05:27:11 |
| - | 3717873_MatoSpectoru_judy_hopps_comm_fullcolor_ps_suit_penis_cum.png | 633397 | 2025-07-12 05:27:11 |
| - | 3717874_MatoSpectoru_judy_hopps_comm_fullcolor_ps_suit_pr.json | 33654 | 2025-07-12 05:27:12 |
| - | 3717874_MatoSpectoru_judy_hopps_comm_fullcolor_ps_suit_pr.png | 680133 | 2025-07-12 05:27:12 |
| - | 3720271_MatoSpectoru_vex_lol_fullcolor_ps_16.json | 22389 | 2025-07-12 04:59:59 |
| - | 3720271_MatoSpectoru_vex_lol_fullcolor_ps_16.png | 739307 | 2025-07-12 04:59:59 |
| - | 3720272_MatoSpectoru_vex_lol_fullcolor_ps_16_futa.json | 22389 | 2025-07-12 04:59:59 |
| - | 3720272_MatoSpectoru_vex_lol_fullcolor_ps_16_futa.png | 894252 | 2025-07-12 04:59:59 |
| - | 3720274_MatoSpectoru_vex_lol_fullcolor_ps_16_futa_c.json | 22389 | 2025-07-12 05:00:00 |
| - | 3720274_MatoSpectoru_vex_lol_fullcolor_ps_16_futa_c.png | 903527 | 2025-07-12 05:00:00 |
| - | 3720275_MatoSpectoru_vex_lol_fullcolor_ps_18.json | 22389 | 2025-07-12 04:59:59 |
| - | 3720275_MatoSpectoru_vex_lol_fullcolor_ps_18.png | 803078 | 2025-07-12 04:59:59 |
| - | 3720276_MatoSpectoru_vex_lol_fullcolor_ps_18_futa.json | 22389 | 2025-07-12 05:00:00 |
| - | 3720276_MatoSpectoru_vex_lol_fullcolor_ps_18_futa.png | 949261 | 2025-07-12 05:00:00 |
| - | 3720277_MatoSpectoru_vex_lol_fullcolor_ps_18_futa_c.json | 22389 | 2025-07-12 05:00:00 |
| - | 3720277_MatoSpectoru_vex_lol_fullcolor_ps_18_futa_c.png | 956446 | 2025-07-12 05:00:00 |
| - | 3720278_MatoSpectoru_vex_lol_fullcolor_ps_18_milk.json | 22389 | 2025-07-12 04:59:59 |
| - | 3720278_MatoSpectoru_vex_lol_fullcolor_ps_18_milk.png | 924520 | 2025-07-12 04:59:59 |
| - | 3726480_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_nude.json | 19046 | 2025-07-12 03:58:26 |
| - | 3726480_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_nude.png | 884829 | 2025-07-12 03:58:26 |
| - | 3726481_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_nude_gl.json | 19046 | 2025-07-12 03:58:25 |
| - | 3726481_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_nude_gl.png | 976838 | 2025-07-12 03:58:25 |
| - | 3726482_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_suit_a.json | 19046 | 2025-07-12 03:58:25 |
| - | 3726482_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_suit_a.png | 879648 | 2025-07-12 03:58:25 |
| - | 3726483_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_suit_a2.json | 19046 | 2025-07-12 03:58:25 |
| - | 3726483_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_suit_a2.png | 961561 | 2025-07-12 03:58:25 |
| - | 3726484_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_suit_a2_gl.json | 19046 | 2025-07-12 03:58:24 |
| - | 3726484_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_suit_a2_gl.png | 1058490 | 2025-07-12 03:58:24 |
| - | 3726485_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_suit_a_gl.json | 19046 | 2025-07-12 03:58:24 |
| - | 3726485_MatoSpectoru_kally_bust_style_comm_fullcolor_ps_suit_a_gl.png | 969370 | 2025-07-12 03:58:24 |
| - | 3729527_MatoSpectoru_matospectoru_comm_2021_table_3.0_inkbunny_lr.json | 24429 | 2025-07-12 03:29:50 |
| - | 3729527_MatoSpectoru_matospectoru_comm_2021_table_3.0_inkbunny_lr.png | 5290326 | 2025-07-12 03:29:50 |
| - | 3729531_MatoSpectoru_matospectoru_comm_2021_table_3.0_inkbunny_fullcolor.json | 24429 | 2025-07-12 03:29:51 |
| - | 3729531_MatoSpectoru_matospectoru_comm_2021_table_3.0_inkbunny_fullcolor.png | 2199766 | 2025-07-12 03:29:51 |
| - | 3729532_MatoSpectoru_matospectoru_comm_2021_table_3.0_inkbunny_flatlcolor.json | 24429 | 2025-07-12 03:29:51 |
| - | 3729532_MatoSpectoru_matospectoru_comm_2021_table_3.0_inkbunny_flatlcolor.png | 641856 | 2025-07-12 03:29:51 |
| - | 3729533_MatoSpectoru_matospectoru_comm_2021_table_3.0_inkbunny_sketch.json | 24429 | 2025-07-12 03:29:51 |
| - | 3729533_MatoSpectoru_matospectoru_comm_2021_table_3.0_inkbunny_sketch.png | 710264 | 2025-07-12 03:29:51 |
| - | 3729534_MatoSpectoru_matospectoru_comm_2021_table_3.0_inkbunny_bs.json | 24429 | 2025-07-12 03:29:51 |
| - | 3729534_MatoSpectoru_matospectoru_comm_2021_table_3.0_inkbunny_bs.png | 1583362 | 2025-07-12 03:29:51 |
| - | 3790506_MatoSpectoru_004_justine_oc_comm_fullcolor_ps.json | 8202 | 2025-07-11 18:01:36 |
| - | 3790506_MatoSpectoru_004_justine_oc_comm_fullcolor_ps.png | 692946 | 2025-07-11 18:01:36 |
| - | 3790514_MatoSpectoru_004_celeste_pikachu_oc_comm_fullcolor_ps_a1.json | 11802 | 2025-07-11 18:01:25 |
| - | 3790514_MatoSpectoru_004_celeste_pikachu_oc_comm_fullcolor_ps_a1.png | 896898 | 2025-07-11 18:01:25 |
| - | 3790516_MatoSpectoru_celeste_pikachu_oc_comm_fullcolor_ps_a2.json | 11802 | 2025-07-11 18:01:24 |
| - | 3790516_MatoSpectoru_celeste_pikachu_oc_comm_fullcolor_ps_a2.png | 1034505 | 2025-07-11 18:01:24 |
| - | 3790543_MatoSpectoru_004_nangi_x_xin_oc_comm_fullcolor_ps_retouch_f.json | 9073 | 2025-07-11 18:01:07 |
| - | 3790543_MatoSpectoru_004_nangi_x_xin_oc_comm_fullcolor_ps_retouch_f.png | 1133929 | 2025-07-11 18:01:07 |
| - | 3790548_MatoSpectoru_nina_tucker_comm_fullcolor_fps.json | 11902 | 2025-07-11 18:01:03 |
| - | 3790548_MatoSpectoru_nina_tucker_comm_fullcolor_fps.png | 951684 | 2025-07-11 18:01:03 |
| - | 3790550_MatoSpectoru_nina_tucker_comm_fullcolor_fps_b.json | 11902 | 2025-07-11 18:01:04 |
| - | 3790550_MatoSpectoru_nina_tucker_comm_fullcolor_fps_b.png | 1171935 | 2025-07-11 18:01:04 |
| - | 3790556_MatoSpectoru_avina_bladefin_oc_comm_fullcolor_a_ps.json | 16542 | 2025-07-11 18:00:57 |
| - | 3790556_MatoSpectoru_avina_bladefin_oc_comm_fullcolor_a_ps.png | 853631 | 2025-07-11 18:00:57 |
| - | 3790559_MatoSpectoru_avina_bladefin_oc_comm_fullcolor_a2_ps.json | 16542 | 2025-07-11 18:00:57 |
| - | 3790559_MatoSpectoru_avina_bladefin_oc_comm_fullcolor_a2_ps.png | 965159 | 2025-07-11 18:00:57 |
| - | 3790561_MatoSpectoru_avina_bladefin_oc_comm_fullcolor_b_ps.json | 16542 | 2025-07-11 18:00:57 |
| - | 3790561_MatoSpectoru_avina_bladefin_oc_comm_fullcolor_b_ps.png | 879168 | 2025-07-11 18:00:57 |
| - | 3790563_MatoSpectoru_avina_bladefin_oc_comm_fullcolor_b2_ps.json | 16542 | 2025-07-11 18:00:58 |
| - | 3790563_MatoSpectoru_avina_bladefin_oc_comm_fullcolor_b2_ps.png | 992063 | 2025-07-11 18:00:58 |
| - | 3790567_MatoSpectoru_hinata_oc_bust_style_comm_flatcolor_nude_a.json | 8473 | 2025-07-11 18:00:53 |
| - | 3790567_MatoSpectoru_hinata_oc_bust_style_comm_flatcolor_nude_a.png | 753521 | 2025-07-11 18:00:53 |
| - | 3790574_MatoSpectoru_fay_holmes_oc_cs_comm_fullcolor_ps_suit_gl.json | 16111 | 2025-07-11 18:00:49 |
| - | 3790574_MatoSpectoru_fay_holmes_oc_cs_comm_fullcolor_ps_suit_gl.png | 669418 | 2025-07-11 18:00:49 |
| - | 3790576_MatoSpectoru_fay_holmes_oc_cs_comm_fullcolor_ps_suit.json | 16111 | 2025-07-11 18:00:49 |
| - | 3790576_MatoSpectoru_fay_holmes_oc_cs_comm_fullcolor_ps_suit.png | 664543 | 2025-07-11 18:00:49 |
| - | 3790579_MatoSpectoru_fay_holmes_oc_cs_comm_fullcolor_ps_nude_gl.json | 16111 | 2025-07-11 18:00:49 |
| - | 3790579_MatoSpectoru_fay_holmes_oc_cs_comm_fullcolor_ps_nude_gl.png | 654242 | 2025-07-11 18:00:49 |
| - | 3790582_MatoSpectoru_fay_holmes_oc_cs_comm_fullcolor_ps_nude.json | 16111 | 2025-07-11 18:00:49 |
| - | 3790582_MatoSpectoru_fay_holmes_oc_cs_comm_fullcolor_ps_nude.png | 589921 | 2025-07-11 18:00:49 |
| - | 3790584_MatoSpectoru_meg_oc_comm_flatcolor_a.json | 11328 | 2025-07-11 18:00:41 |
| - | 3790584_MatoSpectoru_meg_oc_comm_flatcolor_a.png | 1031332 | 2025-07-11 18:00:41 |
| - | 3790588_MatoSpectoru_meg_oc_comm_flatcolor_a2.json | 11328 | 2025-07-11 18:00:43 |
| - | 3790588_MatoSpectoru_meg_oc_comm_flatcolor_a2.png | 1089699 | 2025-07-11 18:00:43 |
| - | 3790592_MatoSpectoru_sally_acorn_comm_fullcolor_ps_a.json | 19256 | 2025-07-11 18:00:31 |
| - | 3790592_MatoSpectoru_sally_acorn_comm_fullcolor_ps_a.png | 592340 | 2025-07-11 18:00:31 |
| - | 3790593_MatoSpectoru_sally_acorn_comm_fullcolor_ps_a_pr.json | 19256 | 2025-07-11 18:00:32 |
| - | 3790593_MatoSpectoru_sally_acorn_comm_fullcolor_ps_a_pr.png | 601585 | 2025-07-11 18:00:32 |
| - | 3790594_MatoSpectoru_sally_acorn_comm_fullcolor_ps_b.json | 19256 | 2025-07-11 18:00:33 |
| - | 3790594_MatoSpectoru_sally_acorn_comm_fullcolor_ps_b.png | 591204 | 2025-07-11 18:00:33 |
| - | 3790595_MatoSpectoru_sally_acorn_comm_fullcolor_ps_c.json | 19256 | 2025-07-11 18:00:33 |
| - | 3790595_MatoSpectoru_sally_acorn_comm_fullcolor_ps_c.png | 624455 | 2025-07-11 18:00:33 |
| - | 3790596_MatoSpectoru_sally_acorn_comm_fullcolor_ps_c_pr.json | 19256 | 2025-07-11 18:00:34 |
| - | 3790596_MatoSpectoru_sally_acorn_comm_fullcolor_ps_c_pr.png | 659965 | 2025-07-11 18:00:34 |
| - | 3790597_MatoSpectoru_sally_acorn_comm_fullcolor_ps_sfw.json | 19256 | 2025-07-11 18:00:31 |
| - | 3790597_MatoSpectoru_sally_acorn_comm_fullcolor_ps_sfw.png | 593290 | 2025-07-11 18:00:31 |
| - | 3790607_MatoSpectoru_midna_x_rouge_halloween_2021_ps_a.json | 18519 | 2025-07-11 18:00:21 |
| - | 3790607_MatoSpectoru_midna_x_rouge_halloween_2021_ps_a.png | 1215502 | 2025-07-11 18:00:21 |
| - | 3790608_MatoSpectoru_midna_x_rouge_halloween_2021_ps_a2.json | 18519 | 2025-07-11 18:00:22 |
| - | 3790608_MatoSpectoru_midna_x_rouge_halloween_2021_ps_a2.png | 1224662 | 2025-07-11 18:00:22 |
| - | 3790610_MatoSpectoru_midna_x_rouge_halloween_2021_ps_a2_pumpkin.json | 18519 | 2025-07-11 18:00:22 |
| - | 3790610_MatoSpectoru_midna_x_rouge_halloween_2021_ps_a2_pumpkin.png | 1459203 | 2025-07-11 18:00:22 |
| - | 3790612_MatoSpectoru_midna_x_rouge_halloween_2021_ps_a_pumpkin.json | 18519 | 2025-07-11 18:00:21 |
| - | 3790612_MatoSpectoru_midna_x_rouge_halloween_2021_ps_a_pumpkin.png | 1450720 | 2025-07-11 18:00:21 |
| - | 3804751_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a1.json | 22150 | 2025-07-11 16:00:49 |
| - | 3804751_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a1.png | 1134893 | 2025-07-11 16:00:49 |
| - | 3804752_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a1_globe.json | 22150 | 2025-07-11 16:00:49 |
| - | 3804752_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a1_globe.png | 1314798 | 2025-07-11 16:00:49 |
| - | 3804753_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a2.json | 22150 | 2025-07-11 16:00:49 |
| - | 3804753_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a2.png | 1257558 | 2025-07-11 16:00:49 |
| - | 3804754_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a3.json | 22150 | 2025-07-11 16:00:49 |
| - | 3804754_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a3.png | 1259723 | 2025-07-11 16:00:49 |
| - | 3804755_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a4.json | 22150 | 2025-07-11 16:00:49 |
| - | 3804755_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a4.png | 1265118 | 2025-07-11 16:00:49 |
| - | 3804757_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a5.json | 22150 | 2025-07-11 16:00:49 |
| - | 3804757_MatoSpectoru_kaze_x_blue_bunny_comm_fullcolor_ps_a5.png | 1224784 | 2025-07-11 16:00:49 |
| - | 3913866_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_01.json | 65631 | 2025-07-11 00:07:24 |
| - | 3913866_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_01.png | 1461584 | 2025-07-11 00:07:24 |
| - | 3913868_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_02.json | 65631 | 2025-07-11 00:07:24 |
| - | 3913868_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_02.png | 1628203 | 2025-07-11 00:07:24 |
| - | 3913869_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_03.json | 65631 | 2025-07-11 00:07:25 |
| - | 3913869_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_03.png | 1646211 | 2025-07-11 00:07:25 |
| - | 3913871_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_07.json | 65631 | 2025-07-11 00:07:25 |
| - | 3913871_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_07.png | 1521334 | 2025-07-11 00:07:25 |
| - | 3913873_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_08.json | 65631 | 2025-07-11 00:07:25 |
| - | 3913873_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_08.png | 1644647 | 2025-07-11 00:07:25 |
| - | 3913875_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_09.json | 65631 | 2025-07-11 00:07:25 |
| - | 3913875_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_09.png | 1800592 | 2025-07-11 00:07:25 |
| - | 3913876_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_10.json | 65631 | 2025-07-11 00:07:25 |
| - | 3913876_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_10.png | 1829892 | 2025-07-11 00:07:25 |
| - | 3913879_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_11.json | 65631 | 2025-07-11 00:07:26 |
| - | 3913879_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_11.png | 1818954 | 2025-07-11 00:07:26 |
| - | 3913880_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_12.json | 65631 | 2025-07-11 00:07:26 |
| - | 3913880_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_12.png | 1846005 | 2025-07-11 00:07:26 |
| - | 3913882_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_13.json | 65631 | 2025-07-11 00:07:27 |
| - | 3913882_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_13.png | 1362625 | 2025-07-11 00:07:27 |
| - | 3913884_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_14.json | 65631 | 2025-07-11 00:07:27 |
| - | 3913884_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_14.png | 1533379 | 2025-07-11 00:07:27 |
| - | 3913885_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_15.json | 65631 | 2025-07-11 00:07:28 |
| - | 3913885_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_15.png | 1546492 | 2025-07-11 00:07:28 |
| - | 3913886_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_16.json | 65631 | 2025-07-11 00:07:28 |
| - | 3913886_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_16.png | 1420100 | 2025-07-11 00:07:28 |
| - | 3913887_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_19.json | 65631 | 2025-07-11 00:07:28 |
| - | 3913887_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_19.png | 1548116 | 2025-07-11 00:07:28 |
| - | 3913890_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_20.json | 65631 | 2025-07-11 00:07:29 |
| - | 3913890_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_20.png | 1705402 | 2025-07-11 00:07:29 |
| - | 3913891_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_21.json | 65631 | 2025-07-11 00:07:29 |
| - | 3913891_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_21.png | 1816218 | 2025-07-11 00:07:29 |
| - | 3913892_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_22.json | 65631 | 2025-07-11 00:07:29 |
| - | 3913892_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_22.png | 1851037 | 2025-07-11 00:07:29 |
| - | 3913893_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_23.json | 65631 | 2025-07-11 00:07:29 |
| - | 3913893_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_23.png | 1863873 | 2025-07-11 00:07:29 |
| - | 3913894_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_24.json | 65631 | 2025-07-11 00:07:30 |
| - | 3913894_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_24.png | 1830088 | 2025-07-11 00:07:30 |
| - | 3913897_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_25.json | 65631 | 2025-07-11 00:07:30 |
| - | 3913897_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_25.png | 1358259 | 2025-07-11 00:07:30 |
| - | 3913898_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_26.json | 65631 | 2025-07-11 00:07:30 |
| - | 3913898_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_26.png | 1528253 | 2025-07-11 00:07:30 |
| - | 3913899_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_27.json | 65631 | 2025-07-11 00:07:30 |
| - | 3913899_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_27.png | 1417316 | 2025-07-11 00:07:30 |
| - | 3913900_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_28.json | 65631 | 2025-07-11 00:07:30 |
| - | 3913900_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_28.png | 1540024 | 2025-07-11 00:07:30 |
| - | 3913903_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_31.json | 65631 | 2025-07-11 00:07:31 |
| - | 3913903_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_31.png | 1544079 | 2025-07-11 00:07:31 |
| - | 3913905_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_32.json | 65631 | 2025-07-11 00:07:31 |
| - | 3913905_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_32.png | 1701278 | 2025-07-11 00:07:31 |
| - | 3913906_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_33.json | 65631 | 2025-07-11 00:07:31 |
| - | 3913906_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_33.png | 1808819 | 2025-07-11 00:07:31 |
| - | 3913907_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_34.json | 65631 | 2025-07-11 00:07:31 |
| - | 3913907_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_34.png | 1844547 | 2025-07-11 00:07:31 |
| - | 3913909_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_35.json | 65631 | 2025-07-11 00:07:31 |
| - | 3913909_MatoSpectoru_carrot_x_friends_comm_fullcolor_ps_e_35.png | 1856261 | 2025-07-11 00:07:31 |
| - | 3930247_MatoSpectoru_nicole_watterson_fullcolor_f.json | 8795 | 2025-07-10 21:39:58 |
| - | 3930247_MatoSpectoru_nicole_watterson_fullcolor_f.png | 1237342 | 2025-07-10 21:39:58 |
| - | 3930251_MatoSpectoru_004_rai_panda_comm_flatcolor_f.json | 12465 | 2025-07-10 21:39:56 |
| - | 3930251_MatoSpectoru_004_rai_panda_comm_flatcolor_f.png | 547202 | 2025-07-10 21:39:56 |
| - | 3930256_MatoSpectoru_rai_panda_oc_2_comm_flatcolor_f.json | 12465 | 2025-07-10 21:39:56 |
| - | 3930256_MatoSpectoru_rai_panda_oc_2_comm_flatcolor_f.png | 528324 | 2025-07-10 21:39:56 |
| - | 3930260_MatoSpectoru_rei_darkblade_oc_comm_fullcolor_ps_b.json | 12076 | 2025-07-10 21:39:52 |
| - | 3930260_MatoSpectoru_rei_darkblade_oc_comm_fullcolor_ps_b.png | 750041 | 2025-07-10 21:39:52 |
| - | 3930264_MatoSpectoru_rei_darkblade_oc_comm_fullcolor_ps_a.json | 12076 | 2025-07-10 21:39:52 |
| - | 3930264_MatoSpectoru_rei_darkblade_oc_comm_fullcolor_ps_a.png | 682149 | 2025-07-10 21:39:52 |
| - | 3930269_MatoSpectoru_yaya_panda_comm_flatcolor_f.json | 9261 | 2025-07-10 21:39:47 |
| - | 3930269_MatoSpectoru_yaya_panda_comm_flatcolor_f.png | 586786 | 2025-07-10 21:39:47 |
| - | 3930277_MatoSpectoru_kunoa_ninja_frog_cs_comm_flatcolor_f.json | 9084 | 2025-07-10 21:39:43 |
| - | 3930277_MatoSpectoru_kunoa_ninja_frog_cs_comm_flatcolor_f.png | 717182 | 2025-07-10 21:39:43 |
| - | 3930281_MatoSpectoru_violet_gardevoir_oc_comm_fullcolor_psa1.json | 12193 | 2025-07-10 21:39:41 |
| - | 3930281_MatoSpectoru_violet_gardevoir_oc_comm_fullcolor_psa1.png | 1058376 | 2025-07-10 21:39:41 |
| - | 3930282_MatoSpectoru_violet_gardevoir_oc_comm_fullcolor_psa2.json | 12193 | 2025-07-10 21:39:41 |
| - | 3930282_MatoSpectoru_violet_gardevoir_oc_comm_fullcolor_psa2.png | 1069326 | 2025-07-10 21:39:41 |
| - | 3930284_MatoSpectoru_004_jonah_oc_comm_fullcolor_ps_f.json | 8760 | 2025-07-10 21:39:40 |
| - | 3930284_MatoSpectoru_004_jonah_oc_comm_fullcolor_ps_f.png | 744250 | 2025-07-10 21:39:40 |
| - | 3930287_MatoSpectoru_toriel_bust_mouse_pad_crop_f_suit_full_f.json | 12210 | 2025-07-10 21:39:38 |
| - | 3930287_MatoSpectoru_toriel_bust_mouse_pad_crop_f_suit_full_f.png | 667603 | 2025-07-10 21:39:38 |
| - | 3930288_MatoSpectoru_toriel_bust_mouse_pad_crop_f_nude_f.json | 12210 | 2025-07-10 21:39:38 |
| - | 3930288_MatoSpectoru_toriel_bust_mouse_pad_crop_f_nude_f.png | 647282 | 2025-07-10 21:39:38 |
| - | 3930291_MatoSpectoru_buffy-sugo_2_comm_fullcolor_psfa.json | 18988 | 2025-07-10 21:39:35 |
| - | 3930291_MatoSpectoru_buffy-sugo_2_comm_fullcolor_psfa.png | 668855 | 2025-07-10 21:39:35 |
| - | 3930299_MatoSpectoru_buffy-sugo_2_comm_fullcolor_psfa4.json | 18988 | 2025-07-10 21:39:35 |
| - | 3930299_MatoSpectoru_buffy-sugo_2_comm_fullcolor_psfa4.png | 681253 | 2025-07-10 21:39:35 |
| - | 3930301_MatoSpectoru_buffy-sugo_2_comm_fullcolor_psfa4futa.json | 18988 | 2025-07-10 21:39:35 |
| - | 3930301_MatoSpectoru_buffy-sugo_2_comm_fullcolor_psfa4futa.png | 721716 | 2025-07-10 21:39:35 |
| - | 3930304_MatoSpectoru_buffy-sugo_2_comm_fullcolor_psfafuta.json | 18988 | 2025-07-10 21:39:35 |
| - | 3930304_MatoSpectoru_buffy-sugo_2_comm_fullcolor_psfafuta.png | 709566 | 2025-07-10 21:39:35 |
| - | 3930305_MatoSpectoru_buffy-sugo_2_comm_fullcolor_psfafutacum.json | 18988 | 2025-07-10 21:39:35 |
| - | 3930305_MatoSpectoru_buffy-sugo_2_comm_fullcolor_psfafutacum.png | 712232 | 2025-07-10 21:39:35 |
| - | 3930315_MatoSpectoru_trinity_oc_comm_fullcolor_fpsa.json | 16387 | 2025-07-10 21:39:27 |
| - | 3930315_MatoSpectoru_trinity_oc_comm_fullcolor_fpsa.png | 602015 | 2025-07-10 21:39:27 |
| - | 3930316_MatoSpectoru_trinity_oc_comm_fullcolor_fpsa2.json | 16387 | 2025-07-10 21:39:27 |
| - | 3930316_MatoSpectoru_trinity_oc_comm_fullcolor_fpsa2.png | 668012 | 2025-07-10 21:39:27 |
| - | 3930325_MatoSpectoru_trinity_oc_comm_fullcolor_fpsa3.json | 16387 | 2025-07-10 21:39:28 |
| - | 3930325_MatoSpectoru_trinity_oc_comm_fullcolor_fpsa3.png | 686168 | 2025-07-10 21:39:28 |
| - | 3930328_MatoSpectoru_trinity_oc_comm_fullcolor_fpsa4.json | 16387 | 2025-07-10 21:39:28 |
| - | 3930328_MatoSpectoru_trinity_oc_comm_fullcolor_fpsa4.png | 797459 | 2025-07-10 21:39:28 |
| - | 3930331_MatoSpectoru_trinity_oc_2_comm_fullcolor_fps.json | 16451 | 2025-07-10 21:39:19 |
| - | 3930331_MatoSpectoru_trinity_oc_2_comm_fullcolor_fps.png | 845667 | 2025-07-10 21:39:19 |
| - | 3930333_MatoSpectoru_trinity_oc_2_comm_fullcolor_fps2.json | 16451 | 2025-07-10 21:39:20 |
| - | 3930333_MatoSpectoru_trinity_oc_2_comm_fullcolor_fps2.png | 1113726 | 2025-07-10 21:39:20 |
| - | 3930334_MatoSpectoru_trinity_oc_2_comm_fullcolor_fpspr.json | 16451 | 2025-07-10 21:39:20 |
| - | 3930334_MatoSpectoru_trinity_oc_2_comm_fullcolor_fpspr.png | 912766 | 2025-07-10 21:39:20 |
| - | 3930335_MatoSpectoru_trinity_oc_2_comm_fullcolor_fpspr2.json | 16451 | 2025-07-10 21:39:20 |
| - | 3930335_MatoSpectoru_trinity_oc_2_comm_fullcolor_fpspr2.png | 1124162 | 2025-07-10 21:39:20 |
| - | 3930343_MatoSpectoru_catherine_oc_worgen_comm_flatcolor_f.json | 15117 | 2025-07-10 21:39:11 |
| - | 3930343_MatoSpectoru_catherine_oc_worgen_comm_flatcolor_f.png | 807281 | 2025-07-10 21:39:11 |
| - | 3930344_MatoSpectoru_catherine_oc_worgen_comm_flatcolor_f2.json | 15117 | 2025-07-10 21:39:11 |
| - | 3930344_MatoSpectoru_catherine_oc_worgen_comm_flatcolor_f2.png | 852251 | 2025-07-10 21:39:11 |
| - | 3930346_MatoSpectoru_catherine_oc_worgen_comm_flatcolor_f2_cum.json | 15117 | 2025-07-10 21:39:11 |
| - | 3930346_MatoSpectoru_catherine_oc_worgen_comm_flatcolor_f2_cum.png | 867971 | 2025-07-10 21:39:11 |
| - | 3930349_MatoSpectoru_sayaka_x_friends_comm_fullcolor_ps_fa.json | 17908 | 2025-07-10 21:39:07 |
| - | 3930349_MatoSpectoru_sayaka_x_friends_comm_fullcolor_ps_fa.png | 1176339 | 2025-07-10 21:39:07 |
| - | 3930350_MatoSpectoru_sayaka_x_friends_comm_fullcolor_ps_fa_cum.json | 17908 | 2025-07-10 21:39:07 |
| - | 3930350_MatoSpectoru_sayaka_x_friends_comm_fullcolor_ps_fa_cum.png | 1378054 | 2025-07-10 21:39:07 |
| - | 3930351_MatoSpectoru_sayaka_x_friends_comm_fullcolor_ps_fa2.json | 17908 | 2025-07-10 21:39:08 |
| - | 3930351_MatoSpectoru_sayaka_x_friends_comm_fullcolor_ps_fa2.png | 1048936 | 2025-07-10 21:39:08 |
| - | 3930352_MatoSpectoru_sayaka_x_friends_comm_fullcolor_ps_fa3_lactation.json | 17908 | 2025-07-10 21:39:08 |
| - | 3930352_MatoSpectoru_sayaka_x_friends_comm_fullcolor_ps_fa3_lactation.png | 1200038 | 2025-07-10 21:39:08 |
| - | 3930356_MatoSpectoru_aureli_oc_comm_fullcolor_f1.json | 19508 | 2025-07-10 21:39:02 |
| - | 3930356_MatoSpectoru_aureli_oc_comm_fullcolor_f1.png | 802130 | 2025-07-10 21:39:02 |
| - | 3930359_MatoSpectoru_aureli_oc_comm_fullcolor_f2.json | 19508 | 2025-07-10 21:39:03 |
| - | 3930359_MatoSpectoru_aureli_oc_comm_fullcolor_f2.png | 810555 | 2025-07-10 21:39:03 |
| - | 3930360_MatoSpectoru_aureli_oc_comm_fullcolor_f3.json | 19508 | 2025-07-10 21:39:03 |
| - | 3930360_MatoSpectoru_aureli_oc_comm_fullcolor_f3.png | 863547 | 2025-07-10 21:39:03 |
| - | 3930363_MatoSpectoru_aureli_oc_comm_fullcolor_f4.json | 19508 | 2025-07-10 21:39:05 |
| - | 3930363_MatoSpectoru_aureli_oc_comm_fullcolor_f4.png | 888181 | 2025-07-10 21:39:05 |
| - | 3930364_MatoSpectoru_aureli_oc_comm_fullcolor_f5.json | 19508 | 2025-07-10 21:39:05 |
| - | 3930364_MatoSpectoru_aureli_oc_comm_fullcolor_f5.png | 943678 | 2025-07-10 21:39:05 |
| - | 3930373_MatoSpectoru_tsuyu_asui_merry_kero_mas_fullcolor_hero_suit_a2.json | 13568 | 2025-07-10 21:38:51 |
| - | 3930373_MatoSpectoru_tsuyu_asui_merry_kero_mas_fullcolor_hero_suit_a2.png | 785278 | 2025-07-10 21:38:51 |
| - | 3930375_MatoSpectoru_tsuyu_asui_merry_kero_mas_fullcolor_hero_suit_b2.json | 13568 | 2025-07-10 21:38:51 |
| - | 3930375_MatoSpectoru_tsuyu_asui_merry_kero_mas_fullcolor_hero_suit_b2.png | 682402 | 2025-07-10 21:38:51 |
| - | 3930377_MatoSpectoru_rivet_2022_comm_fullcolor_f1a.json | 13253 | 2025-07-10 21:38:48 |
| - | 3930377_MatoSpectoru_rivet_2022_comm_fullcolor_f1a.png | 818531 | 2025-07-10 21:38:48 |
| - | 3930378_MatoSpectoru_rivet_2022_comm_fullcolor_f2b.json | 13253 | 2025-07-10 21:38:48 |
| - | 3930378_MatoSpectoru_rivet_2022_comm_fullcolor_f2b.png | 830993 | 2025-07-10 21:38:48 |
| - | 3930391_MatoSpectoru_clawroline_kirby_fullcolor_2.0_f2.json | 13944 | 2025-07-10 21:38:31 |
| - | 3930391_MatoSpectoru_clawroline_kirby_fullcolor_2.0_f2.png | 1065726 | 2025-07-10 21:38:31 |
| - | 3930392_MatoSpectoru_clawroline_kirby_fullcolor_2.0_f1.json | 13944 | 2025-07-10 21:38:31 |
| - | 3930392_MatoSpectoru_clawroline_kirby_fullcolor_2.0_f1.png | 1066833 | 2025-07-10 21:38:31 |
| - | 3930394_MatoSpectoru_clawroline_kirby_fullcolor_2.0_f1b.json | 13944 | 2025-07-10 21:38:31 |
| - | 3930394_MatoSpectoru_clawroline_kirby_fullcolor_2.0_f1b.png | 1115274 | 2025-07-10 21:38:31 |
| - | 3930400_MatoSpectoru_rouge_x_zeena_ggf_comm_sketch_f2_w.json | 12791 | 2025-07-10 21:38:28 |
| - | 3930400_MatoSpectoru_rouge_x_zeena_ggf_comm_sketch_f2_w.png | 846262 | 2025-07-10 21:38:28 |
| - | 3930401_MatoSpectoru_zeena_comm_sketch_fb2.json | 12791 | 2025-07-10 21:38:28 |
| - | 3930401_MatoSpectoru_zeena_comm_sketch_fb2.png | 457510 | 2025-07-10 21:38:28 |
| - | 3930403_MatoSpectoru_ankha_comm_f2.json | 9847 | 2025-07-10 21:38:27 |
| - | 3930403_MatoSpectoru_ankha_comm_f2.png | 1586231 | 2025-07-10 21:38:27 |
| - | 3930407_MatoSpectoru_buffy-sugo_3_comm_fullcolor_b1.json | 16779 | 2025-07-10 21:38:21 |
| - | 3930407_MatoSpectoru_buffy-sugo_3_comm_fullcolor_b1.png | 632510 | 2025-07-10 21:38:21 |
| - | 3930408_MatoSpectoru_buffy-sugo_3_comm_fullcolor_c1.json | 16779 | 2025-07-10 21:38:22 |
| - | 3930408_MatoSpectoru_buffy-sugo_3_comm_fullcolor_c1.png | 610701 | 2025-07-10 21:38:22 |
| - | 3930409_MatoSpectoru_buffy-sugo_3_comm_fullcolor_c2.json | 16779 | 2025-07-10 21:38:22 |
| - | 3930409_MatoSpectoru_buffy-sugo_3_comm_fullcolor_c2.png | 633653 | 2025-07-10 21:38:22 |
| - | 3930410_MatoSpectoru_buffy-sugo_3_comm_fullcolor_c3.json | 16779 | 2025-07-10 21:38:22 |
| - | 3930410_MatoSpectoru_buffy-sugo_3_comm_fullcolor_c3.png | 639371 | 2025-07-10 21:38:22 |
| - | 3931208_MatoSpectoru_peridot_dakimakura_front_comm_fullcolor_ps_a_sfw.json | 17301 | 2025-07-13 01:41:27 |
| - | 3931208_MatoSpectoru_peridot_dakimakura_front_comm_fullcolor_ps_a_sfw.png | 556805 | 2025-07-13 01:41:27 |
| - | 3960266_MatoSpectoru_coco_cb4_winner_march_2022_dark_nude.json | 24645 | 2025-07-10 16:37:30 |
| - | 3960266_MatoSpectoru_coco_cb4_winner_march_2022_dark_nude.png | 552064 | 2025-07-10 16:37:30 |
| - | 3960268_MatoSpectoru_coco_cb4_winner_march_2022_dark_original_b.json | 24645 | 2025-07-10 16:37:28 |
| - | 3960268_MatoSpectoru_coco_cb4_winner_march_2022_dark_original_b.png | 592521 | 2025-07-10 16:37:28 |
| - | 3960269_MatoSpectoru_coco_cb4_winner_march_2022_nude.json | 24645 | 2025-07-10 16:37:27 |
| - | 3960269_MatoSpectoru_coco_cb4_winner_march_2022_nude.png | 553005 | 2025-07-10 16:37:27 |
| - | 3960270_MatoSpectoru_coco_cb4_winner_march_2022_original_b.json | 24645 | 2025-07-10 16:37:23 |
| - | 3960270_MatoSpectoru_coco_cb4_winner_march_2022_original_b.png | 601798 | 2025-07-10 16:37:23 |
| - | 3960271_MatoSpectoru_coco_cb4_winner_march_2022_swimsuit_b.json | 24645 | 2025-07-10 16:37:26 |
| - | 3960271_MatoSpectoru_coco_cb4_winner_march_2022_swimsuit_b.png | 544679 | 2025-07-10 16:37:26 |
| - | 3960272_MatoSpectoru_coco_cb4_winner_march_2022_tawna_b.json | 24645 | 2025-07-10 16:37:25 |
| - | 3960272_MatoSpectoru_coco_cb4_winner_march_2022_tawna_b.png | 613401 | 2025-07-10 16:37:25 |
| - | 3961081_MatoSpectoru_coco_cb4_winner_march_2022_nude_pr.json | 24645 | 2025-07-10 16:37:30 |
| - | 3961081_MatoSpectoru_coco_cb4_winner_march_2022_nude_pr.png | 574531 | 2025-07-10 16:37:30 |
| - | 3961082_MatoSpectoru_coco_cb4_winner_march_2022_dark_nude_pr.json | 24645 | 2025-07-10 16:37:31 |
| - | 3961082_MatoSpectoru_coco_cb4_winner_march_2022_dark_nude_pr.png | 574078 | 2025-07-10 16:37:31 |
| - | 3961838_MatoSpectoru_lulu_comm_fullcolor_f3_m2.json | 25930 | 2025-07-10 16:20:34 |
| - | 3961838_MatoSpectoru_lulu_comm_fullcolor_f3_m2.png | 1086007 | 2025-07-10 16:20:34 |
| - | 3961839_MatoSpectoru_lulu_comm_fullcolor_f3_no_hat_m2.json | 25930 | 2025-07-10 16:20:35 |
| - | 3961839_MatoSpectoru_lulu_comm_fullcolor_f3_no_hat_m2.png | 917979 | 2025-07-10 16:20:35 |
| - | 3961840_MatoSpectoru_lulu_comm_fullcolor_f5_m1.json | 25930 | 2025-07-10 16:20:34 |
| - | 3961840_MatoSpectoru_lulu_comm_fullcolor_f5_m1.png | 994064 | 2025-07-10 16:20:34 |
| - | 3961841_MatoSpectoru_lulu_comm_fullcolor_f5_m1_pr.json | 25930 | 2025-07-10 16:20:35 |
| - | 3961841_MatoSpectoru_lulu_comm_fullcolor_f5_m1_pr.png | 1006560 | 2025-07-10 16:20:35 |
| - | 3961842_MatoSpectoru_lulu_comm_fullcolor_f5_m1_pr_cum.json | 25930 | 2025-07-10 16:20:35 |
| - | 3961842_MatoSpectoru_lulu_comm_fullcolor_f5_m1_pr_cum.png | 1015366 | 2025-07-10 16:20:35 |
| - | 3961843_MatoSpectoru_lulu_comm_fullcolor_f5_no_hat_m1_pr.json | 25930 | 2025-07-10 16:20:35 |
| - | 3961843_MatoSpectoru_lulu_comm_fullcolor_f5_no_hat_m1_pr.png | 860657 | 2025-07-10 16:20:35 |
| - | 3961844_MatoSpectoru_lulu_comm_fullcolor_f5_no_hat_m1_pr_cum.json | 25930 | 2025-07-10 16:20:36 |
| - | 3961844_MatoSpectoru_lulu_comm_fullcolor_f5_no_hat_m1_pr_cum.png | 870249 | 2025-07-10 16:20:36 |
| - | 3961845_MatoSpectoru_lulu_comm_fullcolor_f5_no_hat_m2.json | 25930 | 2025-07-10 16:20:35 |
| - | 3961845_MatoSpectoru_lulu_comm_fullcolor_f5_no_hat_m2.png | 847861 | 2025-07-10 16:20:35 |
| - | 3962789_MatoSpectoru_renamon_comm_fullcolor_f1b.json | 14660 | 2025-07-10 16:09:38 |
| - | 3962789_MatoSpectoru_renamon_comm_fullcolor_f1b.png | 714356 | 2025-07-10 16:09:38 |
| - | 3962790_MatoSpectoru_renamon_comm_fullcolor_f3b.json | 14660 | 2025-07-10 16:09:38 |
| - | 3962790_MatoSpectoru_renamon_comm_fullcolor_f3b.png | 886390 | 2025-07-10 16:09:38 |
| - | 3962791_MatoSpectoru_renamon_comm_fullcolor_f2b.json | 14660 | 2025-07-10 16:09:38 |
| - | 3962791_MatoSpectoru_renamon_comm_fullcolor_f2b.png | 800813 | 2025-07-10 16:09:38 |
| - | 3967085_MatoSpectoru_midna_march_2022_comm_fullcolor_f1b.json | 16814 | 2025-07-10 15:26:06 |
| - | 3967085_MatoSpectoru_midna_march_2022_comm_fullcolor_f1b.png | 674747 | 2025-07-10 15:26:06 |
| - | 3967086_MatoSpectoru_midna_march_2022_comm_fullcolor_f2b.json | 16814 | 2025-07-10 15:26:07 |
| - | 3967086_MatoSpectoru_midna_march_2022_comm_fullcolor_f2b.png | 750620 | 2025-07-10 15:26:07 |
| - | 3967087_MatoSpectoru_midna_march_2022_comm_fullcolor_f1c.json | 16814 | 2025-07-10 15:26:07 |
| - | 3967087_MatoSpectoru_midna_march_2022_comm_fullcolor_f1c.png | 677457 | 2025-07-10 15:26:07 |
| - | 3967090_MatoSpectoru_midna_march_2022_comm_fullcolor_f2c.json | 16814 | 2025-07-10 15:26:07 |
| - | 3967090_MatoSpectoru_midna_march_2022_comm_fullcolor_f2c.png | 753378 | 2025-07-10 15:26:07 |
| - | 3990550_MatoSpectoru_lopa_oc_comm_flatcolor_f1.json | 15874 | 2025-07-10 11:41:58 |
| - | 3990550_MatoSpectoru_lopa_oc_comm_flatcolor_f1.png | 562375 | 2025-07-10 11:41:58 |
| - | 3990552_MatoSpectoru_lopa_oc_comm_flatcolor_f1b.json | 15874 | 2025-07-10 11:41:58 |
| - | 3990552_MatoSpectoru_lopa_oc_comm_flatcolor_f1b.png | 559738 | 2025-07-10 11:41:58 |
| - | 3990553_MatoSpectoru_lopa_oc_comm_flatcolor_f2.json | 15874 | 2025-07-10 11:41:58 |
| - | 3990553_MatoSpectoru_lopa_oc_comm_flatcolor_f2.png | 583288 | 2025-07-10 11:41:58 |
| - | 3990555_MatoSpectoru_lopa_oc_comm_flatcolor_f2b.json | 15874 | 2025-07-10 11:41:58 |
| - | 3990555_MatoSpectoru_lopa_oc_comm_flatcolor_f2b.png | 580726 | 2025-07-10 11:41:58 |
| - | 3992738_MatoSpectoru_amiga_samba_de_amigo_fullcolor_f_solo.json | 20720 | 2025-07-10 11:17:05 |
| - | 3992738_MatoSpectoru_amiga_samba_de_amigo_fullcolor_f_solo.png | 1202600 | 2025-07-10 11:17:05 |
| - | 3992739_MatoSpectoru_amiga_samba_de_amigo_fullcolor_f_solo_nude.json | 20720 | 2025-07-10 11:17:06 |
| - | 3992739_MatoSpectoru_amiga_samba_de_amigo_fullcolor_f_solo_nude.png | 1186329 | 2025-07-10 11:17:06 |
| - | 3992740_MatoSpectoru_amiga_samba_de_amigo_fullcolor_nude_f3_solo.json | 20720 | 2025-07-10 11:17:07 |
| - | 3992740_MatoSpectoru_amiga_samba_de_amigo_fullcolor_nude_f3_solo.png | 1243200 | 2025-07-10 11:17:07 |
| - | 3992741_MatoSpectoru_amiga_samba_de_amigo_fullcolor_nude_f4_solo.json | 20720 | 2025-07-10 11:17:07 |
| - | 3992741_MatoSpectoru_amiga_samba_de_amigo_fullcolor_nude_f4_solo.png | 1263780 | 2025-07-10 11:17:07 |
| - | 3992742_MatoSpectoru_amiga_samba_de_amigo_fullcolor_nude_f5_solo.json | 20720 | 2025-07-10 11:17:07 |
| - | 3992742_MatoSpectoru_amiga_samba_de_amigo_fullcolor_nude_f5_solo.png | 1233574 | 2025-07-10 11:17:07 |
| - | 3992743_MatoSpectoru_amiga_samba_de_amigo_fullcolor_suit_f2_solo.json | 20720 | 2025-07-10 11:17:06 |
| - | 3992743_MatoSpectoru_amiga_samba_de_amigo_fullcolor_suit_f2_solo.png | 1243079 | 2025-07-10 11:17:06 |
| - | 3992749_MatoSpectoru_lammy_lamb_comm_sketch_f1.json | 24096 | 2025-07-10 11:17:01 |
| - | 3992749_MatoSpectoru_lammy_lamb_comm_sketch_f1.png | 404977 | 2025-07-10 11:17:01 |
| - | 3992750_MatoSpectoru_lammy_lamb_comm_sketch_f1_t.json | 24096 | 2025-07-10 11:17:01 |
| - | 3992750_MatoSpectoru_lammy_lamb_comm_sketch_f1_t.png | 464178 | 2025-07-10 11:17:01 |
| - | 3992751_MatoSpectoru_lammy_lamb_comm_sketch_f3.json | 24096 | 2025-07-10 11:17:01 |
| - | 3992751_MatoSpectoru_lammy_lamb_comm_sketch_f3.png | 432073 | 2025-07-10 11:17:01 |
| - | 3992752_MatoSpectoru_lammy_lamb_comm_sketch_f3_text.json | 24096 | 2025-07-10 11:17:00 |
| - | 3992752_MatoSpectoru_lammy_lamb_comm_sketch_f3_text.png | 514254 | 2025-07-10 11:17:00 |
| - | 3992753_MatoSpectoru_lammy_lamb_comm_sketch_f4.json | 24096 | 2025-07-10 11:17:01 |
| - | 3992753_MatoSpectoru_lammy_lamb_comm_sketch_f4.png | 398977 | 2025-07-10 11:17:01 |
| - | 3992754_MatoSpectoru_lammy_lamb_comm_sketch_f4_text.json | 24096 | 2025-07-10 11:17:01 |
| - | 3992754_MatoSpectoru_lammy_lamb_comm_sketch_f4_text.png | 488137 | 2025-07-10 11:17:01 |
| - | 3992755_MatoSpectoru_lammy_lamb_comm_sketch_f7.json | 24096 | 2025-07-10 11:17:01 |
| - | 3992755_MatoSpectoru_lammy_lamb_comm_sketch_f7.png | 496556 | 2025-07-10 11:17:01 |
| - | 3992756_MatoSpectoru_lammy_lamb_comm_sketch_f7_text.json | 24096 | 2025-07-10 11:17:01 |
| - | 3992756_MatoSpectoru_lammy_lamb_comm_sketch_f7_text.png | 541000 | 2025-07-10 11:17:01 |
| - | 3992758_MatoSpectoru_vanilla_he_2022_fullcolor_vanilla_suit.json | 15519 | 2025-07-10 11:16:58 |
| - | 3992758_MatoSpectoru_vanilla_he_2022_fullcolor_vanilla_suit.png | 841747 | 2025-07-10 11:16:58 |
| - | 3992759_MatoSpectoru_vanilla_he_2022_fullcolor_rouge_suit.json | 15519 | 2025-07-10 11:16:58 |
| - | 3992759_MatoSpectoru_vanilla_he_2022_fullcolor_rouge_suit.png | 742458 | 2025-07-10 11:16:58 |
| - | 3992760_MatoSpectoru_vanilla_he_2022_fullcolor_nude.json | 15519 | 2025-07-10 11:16:58 |
| - | 3992760_MatoSpectoru_vanilla_he_2022_fullcolor_nude.png | 794785 | 2025-07-10 11:16:58 |
| - | 4006928_MatoSpectoru_carrot_op_comm_flatcolor_f1.json | 9238 | 2025-07-10 09:02:00 |
| - | 4006928_MatoSpectoru_carrot_op_comm_flatcolor_f1.png | 687938 | 2025-07-10 09:02:00 |
| - | 4007288_MatoSpectoru_maggie_cerebella_cosplay_comm_flatcolor_f1.json | 12428 | 2025-07-10 08:59:34 |
| - | 4007288_MatoSpectoru_maggie_cerebella_cosplay_comm_flatcolor_f1.png | 659735 | 2025-07-10 08:59:34 |
| - | 4007289_MatoSpectoru_maggie_cerebella_cosplay_comm_flatcolor_f2.json | 12428 | 2025-07-10 08:59:34 |
| - | 4007289_MatoSpectoru_maggie_cerebella_cosplay_comm_flatcolor_f2.png | 734486 | 2025-07-10 08:59:34 |
| - | 4007293_MatoSpectoru_tasque_manager_fp_april_2022_f1.json | 12707 | 2025-07-10 08:59:30 |
| - | 4007293_MatoSpectoru_tasque_manager_fp_april_2022_f1.png | 1072188 | 2025-07-10 08:59:30 |
| - | 4007296_MatoSpectoru_tasque_manager_fp_april_2022_f1b.json | 12707 | 2025-07-10 08:59:30 |
| - | 4007296_MatoSpectoru_tasque_manager_fp_april_2022_f1b.png | 1173915 | 2025-07-10 08:59:30 |
| - | 4017876_MatoSpectoru_uzume_oc_comm_flatcolor_f3.json | 16050 | 2025-07-10 07:25:13 |
| - | 4017876_MatoSpectoru_uzume_oc_comm_flatcolor_f3.png | 623907 | 2025-07-10 07:25:13 |
| - | 4017878_MatoSpectoru_uzume_oc_comm_flatcolor_f1.json | 16050 | 2025-07-10 07:25:13 |
| - | 4017878_MatoSpectoru_uzume_oc_comm_flatcolor_f1.png | 582928 | 2025-07-10 07:25:13 |
| - | 4017883_MatoSpectoru_uzume_oc_comm_flatcolor_f2.json | 16050 | 2025-07-10 07:25:13 |
| - | 4017883_MatoSpectoru_uzume_oc_comm_flatcolor_f2.png | 587866 | 2025-07-10 07:25:13 |
| - | 4017889_MatoSpectoru_uzume_oc_comm_flatcolor_f4.json | 16050 | 2025-07-10 07:25:13 |
| - | 4017889_MatoSpectoru_uzume_oc_comm_flatcolor_f4.png | 662149 | 2025-07-10 07:25:13 |
| - | 4019134_MatoSpectoru_lopa_oc_2_comm_fullcolor_f1b.json | 16076 | 2025-07-10 07:14:33 |
| - | 4019134_MatoSpectoru_lopa_oc_2_comm_fullcolor_f1b.png | 721646 | 2025-07-10 07:14:33 |
| - | 4019136_MatoSpectoru_lopa_oc_2_comm_fullcolor_f1b_sfw.json | 16076 | 2025-07-10 07:14:33 |
| - | 4019136_MatoSpectoru_lopa_oc_2_comm_fullcolor_f1b_sfw.png | 674194 | 2025-07-10 07:14:33 |
| - | 4019137_MatoSpectoru_lopa_oc_2_comm_fullcolor_f1_sfw.json | 16076 | 2025-07-10 07:14:33 |
| - | 4019137_MatoSpectoru_lopa_oc_2_comm_fullcolor_f1_sfw.png | 672289 | 2025-07-10 07:14:33 |
| - | 4019138_MatoSpectoru_lopa_oc_2_comm_fullcolor_f1.json | 16076 | 2025-07-10 07:14:33 |
| - | 4019138_MatoSpectoru_lopa_oc_2_comm_fullcolor_f1.png | 719557 | 2025-07-10 07:14:33 |
| - | 4031182_MatoSpectoru_gadget_hackwrench_fullcolor_suit_fa.json | 17693 | 2025-07-10 05:23:28 |
| - | 4031182_MatoSpectoru_gadget_hackwrench_fullcolor_suit_fa.png | 1125890 | 2025-07-10 05:23:28 |
| - | 4031186_MatoSpectoru_gadget_hackwrench_fullcolor_suit_fa_tan.json | 17693 | 2025-07-10 05:23:28 |
| - | 4031186_MatoSpectoru_gadget_hackwrench_fullcolor_suit_fa_tan.png | 1122158 | 2025-07-10 05:23:28 |
| - | 4031187_MatoSpectoru_gadget_hackwrench_fullcolor_nude_fa.json | 17693 | 2025-07-10 05:23:28 |
| - | 4031187_MatoSpectoru_gadget_hackwrench_fullcolor_nude_fa.png | 1044271 | 2025-07-10 05:23:28 |
| - | 4031188_MatoSpectoru_gadget_hackwrench_fullcolor_nude_fa_tan.json | 17693 | 2025-07-10 05:23:28 |
| - | 4031188_MatoSpectoru_gadget_hackwrench_fullcolor_nude_fa_tan.png | 1048231 | 2025-07-10 05:23:28 |
| - | 4047666_MatoSpectoru_amy_rose_eggman_suit_comm_fullcolor_eggman_suit_a.json | 15274 | 2025-07-10 02:40:34 |
| - | 4047666_MatoSpectoru_amy_rose_eggman_suit_comm_fullcolor_eggman_suit_a.png | 737588 | 2025-07-10 02:40:34 |
| - | 4047669_MatoSpectoru_amy_rose_eggman_suit_comm_fullcolor_bikini.json | 15274 | 2025-07-10 02:40:35 |
| - | 4047669_MatoSpectoru_amy_rose_eggman_suit_comm_fullcolor_bikini.png | 750714 | 2025-07-10 02:40:35 |
| - | 4047672_MatoSpectoru_004_amy_rose_eggman_suit_comm_fullcolor_nude_a.json | 15274 | 2025-07-10 02:40:35 |
| - | 4047672_MatoSpectoru_004_amy_rose_eggman_suit_comm_fullcolor_nude_a.png | 761511 | 2025-07-10 02:40:35 |
| - | 4052247_MatoSpectoru_loona_comm_fullcolor_suit.json | 13542 | 2025-07-10 01:50:35 |
| - | 4052247_MatoSpectoru_loona_comm_fullcolor_suit.png | 785999 | 2025-07-10 01:50:35 |
| - | 4052248_MatoSpectoru_loona_comm_fullcolor_bikini.json | 13542 | 2025-07-10 01:50:40 |
| - | 4052248_MatoSpectoru_loona_comm_fullcolor_bikini.png | 866271 | 2025-07-10 01:50:40 |
| - | 4052254_MatoSpectoru_loona_comm_fullcolor_nude.json | 13542 | 2025-07-10 01:50:40 |
| - | 4052254_MatoSpectoru_loona_comm_fullcolor_nude.png | 808355 | 2025-07-10 01:50:40 |
| - | 4052329_MatoSpectoru_004_vivian_x_toadette_fullcolor_comm_f1.json | 16767 | 2025-07-10 01:49:11 |
| - | 4052329_MatoSpectoru_004_vivian_x_toadette_fullcolor_comm_f1.png | 969041 | 2025-07-10 01:49:11 |
| - | 4052352_MatoSpectoru_vivian_x_toadette_fullcolor_comm_f2.json | 16767 | 2025-07-10 01:49:12 |
| - | 4052352_MatoSpectoru_vivian_x_toadette_fullcolor_comm_f2.png | 1017172 | 2025-07-10 01:49:12 |
| - | 4052373_MatoSpectoru_vivian_x_toadette_fullcolor_comm_f3a.json | 16767 | 2025-07-10 01:49:12 |
| - | 4052373_MatoSpectoru_vivian_x_toadette_fullcolor_comm_f3a.png | 1020634 | 2025-07-10 01:49:12 |
| - | 4052379_MatoSpectoru_vivian_x_toadette_fullcolor_comm_f3c.json | 16767 | 2025-07-10 01:49:12 |
| - | 4052379_MatoSpectoru_vivian_x_toadette_fullcolor_comm_f3c.png | 1034510 | 2025-07-10 01:49:12 |
| - | 4100257_MatoSpectoru_renamon_2_comm_fullcolor_fa2_2.0.json | 16456 | 2025-07-09 17:45:30 |
| - | 4100257_MatoSpectoru_renamon_2_comm_fullcolor_fa2_2.0.png | 1106928 | 2025-07-09 17:45:30 |
| - | 4100263_MatoSpectoru_renamon_2_comm_fullcolor_fa_2.0.json | 16456 | 2025-07-09 17:45:30 |
| - | 4100263_MatoSpectoru_renamon_2_comm_fullcolor_fa_2.0.png | 1165203 | 2025-07-09 17:45:30 |
| - | 4100267_MatoSpectoru_renamon_2_comm_fullcolor_fa_2.0_m.json | 16456 | 2025-07-09 17:45:31 |
| - | 4100267_MatoSpectoru_renamon_2_comm_fullcolor_fa_2.0_m.png | 1212443 | 2025-07-09 17:45:31 |
| - | 4100270_MatoSpectoru_renamon_2_comm_fullcolor_fa_2.0_c.json | 16456 | 2025-07-09 17:45:31 |
| - | 4100270_MatoSpectoru_renamon_2_comm_fullcolor_fa_2.0_c.png | 1263766 | 2025-07-09 17:45:31 |
| - | 4101155_MatoSpectoru_vanny_comm_fullcolor_f1_text.json | 15989 | 2025-07-09 17:36:10 |
| - | 4101155_MatoSpectoru_vanny_comm_fullcolor_f1_text.png | 1115880 | 2025-07-09 17:36:10 |
| - | 4101540_MatoSpectoru_vanny_comm_fullcolor_f1_text_c.json | 15989 | 2025-07-09 17:36:10 |
| - | 4101540_MatoSpectoru_vanny_comm_fullcolor_f1_text_c.png | 1198796 | 2025-07-09 17:36:10 |
| - | 4101597_MatoSpectoru_vanny_comm_fullcolor_f1.json | 15989 | 2025-07-09 17:36:10 |
| - | 4101597_MatoSpectoru_vanny_comm_fullcolor_f1.png | 894701 | 2025-07-09 17:36:10 |
| - | 4101770_MatoSpectoru_vanny_comm_fullcolor_f1_c.json | 15989 | 2025-07-09 17:36:11 |
| - | 4101770_MatoSpectoru_vanny_comm_fullcolor_f1_c.png | 1071344 | 2025-07-09 17:36:11 |
| - | 4168407_MatoSpectoru_mina_mongoose_2022_comm_fullcolor_f1.json | 15180 | 2025-07-09 07:35:18 |
| - | 4168407_MatoSpectoru_mina_mongoose_2022_comm_fullcolor_f1.png | 762287 | 2025-07-09 07:35:18 |
| - | 4168408_MatoSpectoru_mina_mongoose_2022_comm_fullcolor_f1.5.json | 15180 | 2025-07-09 07:35:18 |
| - | 4168408_MatoSpectoru_mina_mongoose_2022_comm_fullcolor_f1.5.png | 792584 | 2025-07-09 07:35:18 |
| - | 4168410_MatoSpectoru_mina_mongoose_2022_comm_fullcolor_f2.json | 15180 | 2025-07-09 07:35:19 |
| - | 4168410_MatoSpectoru_mina_mongoose_2022_comm_fullcolor_f2.png | 719495 | 2025-07-09 07:35:19 |
| - | 4168413_MatoSpectoru_amy_rouge_whisper_comm_fullcolor_suit.json | 18033 | 2025-07-10 01:11:32 |
| - | 4168413_MatoSpectoru_amy_rouge_whisper_comm_fullcolor_suit.png | 2081883 | 2025-07-10 01:11:32 |
| - | 4168415_MatoSpectoru_amy_rouge_whisper_comm_fullcolor_suit_b.json | 18033 | 2025-07-10 01:11:33 |
| - | 4168415_MatoSpectoru_amy_rouge_whisper_comm_fullcolor_suit_b.png | 2048833 | 2025-07-10 01:11:33 |
| - | 4168417_MatoSpectoru_amy_rouge_whisper_comm_fullcolor_nude.json | 18033 | 2025-07-10 01:11:33 |
| - | 4168417_MatoSpectoru_amy_rouge_whisper_comm_fullcolor_nude.png | 1967325 | 2025-07-10 01:11:33 |
| - | 4168419_MatoSpectoru_amy_rouge_whisper_comm_fullcolor_nude_l.json | 18033 | 2025-07-10 01:11:33 |
| - | 4168419_MatoSpectoru_amy_rouge_whisper_comm_fullcolor_nude_l.png | 2287369 | 2025-07-10 01:11:33 |
| - | 4168424_MatoSpectoru_ankha_x_sasha_1_comm_fullcolor_f1.json | 15312 | 2025-07-10 01:11:28 |
| - | 4168424_MatoSpectoru_ankha_x_sasha_1_comm_fullcolor_f1.png | 713098 | 2025-07-10 01:11:28 |
| - | 4168425_MatoSpectoru_ankha_x_sasha_1_comm_fullcolor_f1c.json | 15312 | 2025-07-10 01:11:29 |
| - | 4168425_MatoSpectoru_ankha_x_sasha_1_comm_fullcolor_f1c.png | 721710 | 2025-07-10 01:11:29 |
| - | 4168429_MatoSpectoru_ankha_x_sasha_1_comm_fullcolor_f1t.json | 15312 | 2025-07-10 01:11:26 |
| - | 4168429_MatoSpectoru_ankha_x_sasha_1_comm_fullcolor_f1t.png | 762293 | 2025-07-10 01:11:26 |
| - | 4168431_MatoSpectoru_ankha_x_sasha_1_comm_fullcolor_f1ct.json | 15312 | 2025-07-10 01:11:28 |
| - | 4168431_MatoSpectoru_ankha_x_sasha_1_comm_fullcolor_f1ct.png | 782665 | 2025-07-10 01:11:28 |
| - | 4168435_MatoSpectoru_ankha_x_sasha_2_comm_fullcolor_f2bi.json | 14774 | 2025-07-09 07:35:07 |
| - | 4168435_MatoSpectoru_ankha_x_sasha_2_comm_fullcolor_f2bi.png | 689850 | 2025-07-09 07:35:07 |
| - | 4168436_MatoSpectoru_ankha_x_sasha_2_comm_fullcolor_f2bic.json | 14774 | 2025-07-09 07:35:08 |
| - | 4168436_MatoSpectoru_ankha_x_sasha_2_comm_fullcolor_f2bic.png | 693905 | 2025-07-09 07:35:08 |
| - | 4168437_MatoSpectoru_ankha_x_sasha_2_comm_fullcolor_f2i.json | 14774 | 2025-07-09 07:35:07 |
| - | 4168437_MatoSpectoru_ankha_x_sasha_2_comm_fullcolor_f2i.png | 684026 | 2025-07-09 07:35:07 |
| - | 4168438_MatoSpectoru_ankha_x_sasha_2_comm_fullcolor_f2it.json | 14774 | 2025-07-09 07:35:07 |
| - | 4168438_MatoSpectoru_ankha_x_sasha_2_comm_fullcolor_f2it.png | 708981 | 2025-07-09 07:35:07 |
| - | 4168443_MatoSpectoru_ko_oc_comm_fullcolor_f1.json | 15154 | 2025-07-09 07:35:03 |
| - | 4168443_MatoSpectoru_ko_oc_comm_fullcolor_f1.png | 783862 | 2025-07-09 07:35:03 |
| - | 4168444_MatoSpectoru_ko_oc_comm_fullcolor_f1b.json | 15154 | 2025-07-09 07:35:03 |
| - | 4168444_MatoSpectoru_ko_oc_comm_fullcolor_f1b.png | 802504 | 2025-07-09 07:35:03 |
| - | 4168446_MatoSpectoru_ko_oc_comm_fullcolor_f1b2.json | 15154 | 2025-07-09 07:35:03 |
| - | 4168446_MatoSpectoru_ko_oc_comm_fullcolor_f1b2.png | 851022 | 2025-07-09 07:35:03 |
| - | 4168448_MatoSpectoru_ko_oc_comm_fullcolor_f1c.json | 15154 | 2025-07-09 07:35:04 |
| - | 4168448_MatoSpectoru_ko_oc_comm_fullcolor_f1c.png | 776288 | 2025-07-09 07:35:04 |
| - | 4168456_MatoSpectoru_shiver_frye_fullcolor_f1.json | 14822 | 2025-07-10 01:11:18 |
| - | 4168456_MatoSpectoru_shiver_frye_fullcolor_f1.png | 766450 | 2025-07-10 01:11:18 |
| - | 4168458_MatoSpectoru_shiver_frye_fullcolor_f2.json | 14822 | 2025-07-10 01:11:18 |
| - | 4168458_MatoSpectoru_shiver_frye_fullcolor_f2.png | 759197 | 2025-07-10 01:11:18 |
| - | 4168465_MatoSpectoru_shiver_frye_fullcolor_f3.json | 14822 | 2025-07-10 01:11:18 |
| - | 4168465_MatoSpectoru_shiver_frye_fullcolor_f3.png | 648717 | 2025-07-10 01:11:18 |
| - | 4168468_MatoSpectoru_kanna_bmz_fp_fullcolor_suit_a1_h_t.json | 19889 | 2025-07-09 07:34:52 |
| - | 4168468_MatoSpectoru_kanna_bmz_fp_fullcolor_suit_a1_h_t.png | 828431 | 2025-07-09 07:34:52 |
| - | 4168469_MatoSpectoru_kanna_bmz_fp_fullcolor_suit_a1_h.json | 19889 | 2025-07-09 07:34:52 |
| - | 4168469_MatoSpectoru_kanna_bmz_fp_fullcolor_suit_a1_h.png | 788136 | 2025-07-09 07:34:52 |
| - | 4168470_MatoSpectoru_kanna_bmz_fp_fullcolor_suit_a2_h.json | 19889 | 2025-07-09 07:34:52 |
| - | 4168470_MatoSpectoru_kanna_bmz_fp_fullcolor_suit_a2_h.png | 799022 | 2025-07-09 07:34:52 |
| - | 4168472_MatoSpectoru_kanna_bmz_fp_fullcolor_suit_a3_h.json | 19889 | 2025-07-09 07:34:53 |
| - | 4168472_MatoSpectoru_kanna_bmz_fp_fullcolor_suit_a3_h.png | 780102 | 2025-07-09 07:34:53 |
| - | 4168475_MatoSpectoru_kanna_bmz_fp_fullcolor_nude_a1_h.json | 19889 | 2025-07-09 07:34:53 |
| - | 4168475_MatoSpectoru_kanna_bmz_fp_fullcolor_nude_a1_h.png | 665881 | 2025-07-09 07:34:53 |
| - | 4168477_MatoSpectoru_kanna_bmz_fp_fullcolor_nude_a2_h.json | 19889 | 2025-07-09 07:34:53 |
| - | 4168477_MatoSpectoru_kanna_bmz_fp_fullcolor_nude_a2_h.png | 662447 | 2025-07-09 07:34:53 |
| - | 4168482_MatoSpectoru_sally_acorn_x_sonic_comm_fullcolor_f1b.json | 15690 | 2025-07-09 07:34:48 |
| - | 4168482_MatoSpectoru_sally_acorn_x_sonic_comm_fullcolor_f1b.png | 488597 | 2025-07-09 07:34:48 |
| - | 4168483_MatoSpectoru_sally_acorn_x_sonic_comm_fullcolor_f1bt.json | 15690 | 2025-07-09 07:34:48 |
| - | 4168483_MatoSpectoru_sally_acorn_x_sonic_comm_fullcolor_f1bt.png | 605280 | 2025-07-09 07:34:48 |
| - | 4168485_MatoSpectoru_sally_acorn_x_sonic_comm_fullcolor_f2b.json | 15690 | 2025-07-09 07:34:48 |
| - | 4168485_MatoSpectoru_sally_acorn_x_sonic_comm_fullcolor_f2b.png | 555736 | 2025-07-09 07:34:48 |
| - | 4168555_MatoSpectoru_commissions_prices_2022_ib_f_mr_.json | 21533 | 2025-07-09 07:34:14 |
| - | 4168555_MatoSpectoru_commissions_prices_2022_ib_f_mr_.png | 789570 | 2025-07-09 07:34:14 |
| - | 4168564_MatoSpectoru_commissions_prices_2022_ib_fullcolor_mr_.json | 21533 | 2025-07-09 07:34:15 |
| - | 4168564_MatoSpectoru_commissions_prices_2022_ib_fullcolor_mr_.png | 1963510 | 2025-07-09 07:34:15 |
| - | 4168565_MatoSpectoru_commissions_prices_2022_ib_flatcolor_mr_.json | 21533 | 2025-07-09 07:34:15 |
| - | 4168565_MatoSpectoru_commissions_prices_2022_ib_flatcolor_mr_.png | 493353 | 2025-07-09 07:34:15 |
| - | 4168566_MatoSpectoru_commissions_prices_2022_ib_sketch_mr_.json | 21533 | 2025-07-09 07:34:15 |
| - | 4168566_MatoSpectoru_commissions_prices_2022_ib_sketch_mr_.png | 725370 | 2025-07-09 07:34:15 |
| - | 4205670_MatoSpectoru_niki_oc_fennekin_comm_fullcolor_f1.json | 12836 | 2025-07-09 01:58:35 |
| - | 4205670_MatoSpectoru_niki_oc_fennekin_comm_fullcolor_f1.png | 497996 | 2025-07-09 01:58:35 |
| - | 4205671_MatoSpectoru_niki_oc_fennekin_comm_fullcolor_f2.json | 12836 | 2025-07-09 01:58:35 |
| - | 4205671_MatoSpectoru_niki_oc_fennekin_comm_fullcolor_f2.png | 534618 | 2025-07-09 01:58:35 |
| - | 4205675_MatoSpectoru_thumbeh_kobold_oc_comm_fullcolor_f2.json | 16403 | 2025-07-09 01:58:33 |
| - | 4205675_MatoSpectoru_thumbeh_kobold_oc_comm_fullcolor_f2.png | 579947 | 2025-07-09 01:58:33 |
| - | 4205677_MatoSpectoru_thumbeh_kobold_oc_comm_fullcolor_f2b.json | 16403 | 2025-07-09 01:58:33 |
| - | 4205677_MatoSpectoru_thumbeh_kobold_oc_comm_fullcolor_f2b.png | 561348 | 2025-07-09 01:58:33 |
| - | 4205678_MatoSpectoru_thumbeh_kobold_oc_comm_fullcolor_f1.json | 16403 | 2025-07-09 01:58:34 |
| - | 4205678_MatoSpectoru_thumbeh_kobold_oc_comm_fullcolor_f1.png | 539195 | 2025-07-09 01:58:34 |
| - | 4205681_MatoSpectoru_thumbeh_kobold_oc_comm_fullcolor_f1b.json | 16403 | 2025-07-09 01:58:34 |
| - | 4205681_MatoSpectoru_thumbeh_kobold_oc_comm_fullcolor_f1b.png | 520469 | 2025-07-09 01:58:34 |
| - | 4205683_MatoSpectoru_khajiit_tova_oc_comm_fullcolor_f1.json | 15923 | 2025-07-10 00:13:10 |
| - | 4205683_MatoSpectoru_khajiit_tova_oc_comm_fullcolor_f1.png | 689855 | 2025-07-10 00:13:10 |
| - | 4205685_MatoSpectoru_khajiit_tova_oc_comm_fullcolor_f1t.json | 15923 | 2025-07-10 00:13:13 |
| - | 4205685_MatoSpectoru_khajiit_tova_oc_comm_fullcolor_f1t.png | 770058 | 2025-07-10 00:13:13 |
| - | 4205687_MatoSpectoru_khajiit_tova_oc_comm_fullcolor_f2.json | 15923 | 2025-07-10 00:13:13 |
| - | 4205687_MatoSpectoru_khajiit_tova_oc_comm_fullcolor_f2.png | 703895 | 2025-07-10 00:13:13 |
| - | 4205689_MatoSpectoru_khajiit_tova_oc_comm_fullcolor_f2t.json | 15923 | 2025-07-10 00:13:14 |
| - | 4205689_MatoSpectoru_khajiit_tova_oc_comm_fullcolor_f2t.png | 784575 | 2025-07-10 00:13:14 |
| - | 4205694_MatoSpectoru_beignet_oc_comm_fullcolor_f2.json | 11943 | 2025-07-09 01:58:25 |
| - | 4205694_MatoSpectoru_beignet_oc_comm_fullcolor_f2.png | 578768 | 2025-07-09 01:58:25 |
| - | 4205696_MatoSpectoru_beignet_oc_comm_fullcolor_f1.json | 11943 | 2025-07-09 01:58:26 |
| - | 4205696_MatoSpectoru_beignet_oc_comm_fullcolor_f1.png | 409965 | 2025-07-09 01:58:26 |
| - | 4205699_MatoSpectoru_vicky_oc_victini_comm_fullcolor_f2.json | 14789 | 2025-07-09 01:58:23 |
| - | 4205699_MatoSpectoru_vicky_oc_victini_comm_fullcolor_f2.png | 580466 | 2025-07-09 01:58:23 |
| - | 4205700_MatoSpectoru_vicky_oc_victini_comm_fullcolor_f3.json | 14789 | 2025-07-09 01:58:23 |
| - | 4205700_MatoSpectoru_vicky_oc_victini_comm_fullcolor_f3.png | 564097 | 2025-07-09 01:58:23 |
| - | 4205701_MatoSpectoru_vicky_oc_victini_comm_fullcolor_f1.json | 14789 | 2025-07-09 01:58:23 |
| - | 4205701_MatoSpectoru_vicky_oc_victini_comm_fullcolor_f1.png | 493813 | 2025-07-09 01:58:23 |
| - | 4205705_MatoSpectoru_club_rouge_comm_fullcolor_f1.json | 18352 | 2025-07-10 00:13:03 |
| - | 4205705_MatoSpectoru_club_rouge_comm_fullcolor_f1.png | 932460 | 2025-07-10 00:13:03 |
| - | 4205707_MatoSpectoru_club_rouge_comm_fullcolor_f4.json | 18352 | 2025-07-10 00:13:03 |
| - | 4205707_MatoSpectoru_club_rouge_comm_fullcolor_f4.png | 920205 | 2025-07-10 00:13:03 |
| - | 4205708_MatoSpectoru_club_rouge_comm_fullcolor_f5c.json | 18352 | 2025-07-10 00:13:05 |
| - | 4205708_MatoSpectoru_club_rouge_comm_fullcolor_f5c.png | 930118 | 2025-07-10 00:13:05 |
| - | 4205710_MatoSpectoru_club_rouge_comm_fullcolor_f5c.json | 18352 | 2025-07-10 00:13:06 |
| - | 4205710_MatoSpectoru_club_rouge_comm_fullcolor_f5c.png | 1049892 | 2025-07-10 00:13:06 |
| - | 4205725_MatoSpectoru_toriel_2022_fullcolor_a_f1.json | 15233 | 2025-07-09 01:58:08 |
| - | 4205725_MatoSpectoru_toriel_2022_fullcolor_a_f1.png | 682733 | 2025-07-09 01:58:08 |
| - | 4205726_MatoSpectoru_toriel_2022_fullcolor_b_f1.json | 15233 | 2025-07-09 01:58:08 |
| - | 4205726_MatoSpectoru_toriel_2022_fullcolor_b_f1.png | 595741 | 2025-07-09 01:58:08 |
| - | 4205729_MatoSpectoru_toriel_2022_fullcolor_b_f2.json | 15233 | 2025-07-09 01:58:09 |
| - | 4205729_MatoSpectoru_toriel_2022_fullcolor_b_f2.png | 650656 | 2025-07-09 01:58:09 |
| - | 4205735_MatoSpectoru_taokaka_2022_fullcolor_suit_f1.json | 12127 | 2025-07-09 01:58:03 |
| - | 4205735_MatoSpectoru_taokaka_2022_fullcolor_suit_f1.png | 613978 | 2025-07-09 01:58:03 |
| - | 4205737_MatoSpectoru_taokaka_2022_fullcolor_nude_f1.json | 12127 | 2025-07-09 01:58:03 |
| - | 4205737_MatoSpectoru_taokaka_2022_fullcolor_nude_f1.png | 593084 | 2025-07-09 01:58:03 |
| - | 4303750_MatoSpectoru_maia_acheron_jak_comm_fullcolor_f1.json | 16607 | 2025-07-08 08:45:25 |
| - | 4303750_MatoSpectoru_maia_acheron_jak_comm_fullcolor_f1.png | 584698 | 2025-07-08 08:45:25 |
| - | 4303751_MatoSpectoru_maia_acheron_jak_comm_fullcolor_f1t.json | 16607 | 2025-07-08 08:45:25 |
| - | 4303751_MatoSpectoru_maia_acheron_jak_comm_fullcolor_f1t.png | 643412 | 2025-07-08 08:45:25 |
| - | 4303752_MatoSpectoru_maia_acheron_jak_comm_fullcolor_f2.json | 16607 | 2025-07-08 08:45:26 |
| - | 4303752_MatoSpectoru_maia_acheron_jak_comm_fullcolor_f2.png | 620670 | 2025-07-08 08:45:26 |
| - | 4303753_MatoSpectoru_maia_acheron_jak_comm_fullcolor_f3.json | 16607 | 2025-07-08 08:45:26 |
| - | 4303753_MatoSpectoru_maia_acheron_jak_comm_fullcolor_f3.png | 701429 | 2025-07-08 08:45:26 |
| - | 4303779_MatoSpectoru_loona_is_back_comm_fullcolor_f1.json | 14176 | 2025-07-08 08:45:07 |
| - | 4303779_MatoSpectoru_loona_is_back_comm_fullcolor_f1.png | 485350 | 2025-07-08 08:45:07 |
| - | 4303780_MatoSpectoru_loona_is_back_comm_fullcolor_f1b.json | 14176 | 2025-07-08 08:45:07 |
| - | 4303780_MatoSpectoru_loona_is_back_comm_fullcolor_f1b.png | 495704 | 2025-07-08 08:45:07 |
| - | 4303782_MatoSpectoru_loona_is_back_comm_fullcolor_f2.json | 14176 | 2025-07-08 08:45:07 |
| - | 4303782_MatoSpectoru_loona_is_back_comm_fullcolor_f2.png | 478599 | 2025-07-08 08:45:07 |
| - | 4303801_MatoSpectoru_rouge_t_b_new_design_f1.json | 15072 | 2025-07-08 08:44:52 |
| - | 4303801_MatoSpectoru_rouge_t_b_new_design_f1.png | 911823 | 2025-07-08 08:44:52 |
| - | 4303802_MatoSpectoru_rouge_t_b_new_design_f2.json | 15072 | 2025-07-08 08:44:53 |
| - | 4303802_MatoSpectoru_rouge_t_b_new_design_f2.png | 936558 | 2025-07-08 08:44:53 |
| - | 4303803_MatoSpectoru_rouge_t_b_new_design_f3.json | 15072 | 2025-07-08 08:44:53 |
| - | 4303803_MatoSpectoru_rouge_t_b_new_design_f3.png | 936080 | 2025-07-08 08:44:53 |
| - | 4303812_MatoSpectoru_squigly_fp_october_fullcolor.json | 15858 | 2025-07-08 08:44:41 |
| - | 4303812_MatoSpectoru_squigly_fp_october_fullcolor.png | 769854 | 2025-07-08 08:44:41 |
| - | 4303813_MatoSpectoru_squigly_fp_october_fullcolor_suit.json | 15858 | 2025-07-08 08:44:41 |
| - | 4303813_MatoSpectoru_squigly_fp_october_fullcolor_suit.png | 720398 | 2025-07-08 08:44:41 |
| - | 4303814_MatoSpectoru_squigly_fp_october_fullcolor_sweat.json | 15858 | 2025-07-08 08:44:41 |
| - | 4303814_MatoSpectoru_squigly_fp_october_fullcolor_sweat.png | 848712 | 2025-07-08 08:44:41 |
| - | 4303815_MatoSpectoru_squigly_fp_october_fullcolor_sweat_c.json | 15858 | 2025-07-08 08:44:42 |
| - | 4303815_MatoSpectoru_squigly_fp_october_fullcolor_sweat_c.png | 848134 | 2025-07-08 08:44:42 |
| - | 4303818_MatoSpectoru_marina_x_red_oc_comm_only_marina_fullcolor_f1.json | 17743 | 2025-07-08 08:44:38 |
| - | 4303818_MatoSpectoru_marina_x_red_oc_comm_only_marina_fullcolor_f1.png | 415042 | 2025-07-08 08:44:38 |
| - | 4303820_MatoSpectoru_marina_x_red_oc_comm_only_marina_fullcolor_f1_dialogue.json | 17743 | 2025-07-08 08:44:38 |
| - | 4303820_MatoSpectoru_marina_x_red_oc_comm_only_marina_fullcolor_f1_dialogue.png | 463043 | 2025-07-08 08:44:38 |
| - | 4303821_MatoSpectoru_marina_x_red_oc_comm_only_marina_fullcolor_f2.json | 17743 | 2025-07-08 08:44:38 |
| - | 4303821_MatoSpectoru_marina_x_red_oc_comm_only_marina_fullcolor_f2.png | 428982 | 2025-07-08 08:44:38 |
| - | 4303822_MatoSpectoru_marina_x_red_oc_comm_only_marina_fullcolor_f3.json | 17743 | 2025-07-08 08:44:39 |
| - | 4303822_MatoSpectoru_marina_x_red_oc_comm_only_marina_fullcolor_f3.png | 445646 | 2025-07-08 08:44:39 |
| - | 4303830_MatoSpectoru_crissy_oc_comm_fullcolor_f1a.json | 13372 | 2025-07-08 08:44:34 |
| - | 4303830_MatoSpectoru_crissy_oc_comm_fullcolor_f1a.png | 295068 | 2025-07-08 08:44:34 |
| - | 4303831_MatoSpectoru_crissy_oc_comm_fullcolor_f2a.json | 13372 | 2025-07-08 08:44:34 |
| - | 4303831_MatoSpectoru_crissy_oc_comm_fullcolor_f2a.png | 283419 | 2025-07-08 08:44:34 |
| - | 4303832_MatoSpectoru_crissy_oc_comm_fullcolor_f3a.json | 13372 | 2025-07-08 08:44:34 |
| - | 4303832_MatoSpectoru_crissy_oc_comm_fullcolor_f3a.png | 322997 | 2025-07-08 08:44:34 |
| - | 4303849_MatoSpectoru_gcw_x_gantu_comm_fullcolor_f1.json | 15564 | 2025-07-08 08:44:23 |
| - | 4303849_MatoSpectoru_gcw_x_gantu_comm_fullcolor_f1.png | 940068 | 2025-07-08 08:44:23 |
| - | 4303851_MatoSpectoru_gcw_x_gantu_comm_fullcolor_f1d.json | 15564 | 2025-07-08 08:44:24 |
| - | 4303851_MatoSpectoru_gcw_x_gantu_comm_fullcolor_f1d.png | 998987 | 2025-07-08 08:44:24 |
| - | 4303854_MatoSpectoru_gcw_x_gantu_comm_fullcolor_f2.json | 15564 | 2025-07-08 08:44:24 |
| - | 4303854_MatoSpectoru_gcw_x_gantu_comm_fullcolor_f2.png | 1005516 | 2025-07-08 08:44:24 |
| - | 4303859_MatoSpectoru_yuki_dog_princess_comm_fullcolor_f1.json | 14439 | 2025-07-08 08:44:17 |
| - | 4303859_MatoSpectoru_yuki_dog_princess_comm_fullcolor_f1.png | 685384 | 2025-07-08 08:44:17 |
| - | 4303860_MatoSpectoru_yuki_dog_princess_comm_fullcolor_f2.json | 14439 | 2025-07-08 08:44:17 |
| - | 4303860_MatoSpectoru_yuki_dog_princess_comm_fullcolor_f2.png | 730554 | 2025-07-08 08:44:17 |
| - | 4303861_MatoSpectoru_yuki_dog_princess_comm_fullcolor_f2c.json | 14439 | 2025-07-08 08:44:17 |
| - | 4303861_MatoSpectoru_yuki_dog_princess_comm_fullcolor_f2c.png | 748915 | 2025-07-08 08:44:17 |
| - | 4303887_MatoSpectoru_emoji_alien_comm_fullcolor_f1.json | 16464 | 2025-07-08 08:43:56 |
| - | 4303887_MatoSpectoru_emoji_alien_comm_fullcolor_f1.png | 586176 | 2025-07-08 08:43:56 |
| - | 4303888_MatoSpectoru_emoji_alien_comm_fullcolor_f1t.json | 16464 | 2025-07-08 08:43:56 |
| - | 4303888_MatoSpectoru_emoji_alien_comm_fullcolor_f1t.png | 633714 | 2025-07-08 08:43:56 |
| - | 4303891_MatoSpectoru_emoji_alien_comm_fullcolor_f2.json | 16464 | 2025-07-08 08:43:57 |
| - | 4303891_MatoSpectoru_emoji_alien_comm_fullcolor_f2.png | 589149 | 2025-07-08 08:43:57 |
| - | 4303892_MatoSpectoru_emoji_alien_comm_fullcolor_f2t.json | 16464 | 2025-07-08 08:43:57 |
| - | 4303892_MatoSpectoru_emoji_alien_comm_fullcolor_f2t.png | 636474 | 2025-07-08 08:43:57 |
| - | 4303904_MatoSpectoru_la_pavita_pechugona_comm_fullcolor_nude_f1b.json | 13420 | 2025-07-08 08:43:46 |
| - | 4303904_MatoSpectoru_la_pavita_pechugona_comm_fullcolor_nude_f1b.png | 1058287 | 2025-07-08 08:43:45 |
| - | 4303905_MatoSpectoru_la_pavita_pechugona_comm_fullcolor_nude_f2a2.json | 13420 | 2025-07-08 08:43:46 |
| - | 4303905_MatoSpectoru_la_pavita_pechugona_comm_fullcolor_nude_f2a2.png | 1129889 | 2025-07-08 08:43:46 |
| - | 4303907_MatoSpectoru_la_pavita_pechugona_comm_fullcolor_suit_f1a.json | 13420 | 2025-07-08 08:43:45 |
| - | 4303907_MatoSpectoru_la_pavita_pechugona_comm_fullcolor_suit_f1a.png | 1026640 | 2025-07-08 08:43:45 |
| - | 4303926_MatoSpectoru_roxy_glamrock_chica_comm_fullcolor_part1_f1.json | 16195 | 2025-07-08 08:43:30 |
| - | 4303926_MatoSpectoru_roxy_glamrock_chica_comm_fullcolor_part1_f1.png | 969843 | 2025-07-08 08:43:30 |
| - | 4303927_MatoSpectoru_roxy_glamrock_chica_comm_fullcolor_part1_f1l.json | 16195 | 2025-07-08 08:43:31 |
| - | 4303927_MatoSpectoru_roxy_glamrock_chica_comm_fullcolor_part1_f1l.png | 995416 | 2025-07-08 08:43:31 |
| - | 4303929_MatoSpectoru_roxy_glamrock_chica_comm_fullcolor_part1_f1t.json | 16195 | 2025-07-08 08:43:31 |
| - | 4303929_MatoSpectoru_roxy_glamrock_chica_comm_fullcolor_part1_f1t.png | 987909 | 2025-07-08 08:43:31 |
| - | 4303943_MatoSpectoru_carmelita_fox_fanart_poll_fullcolor_nude_f1.json | 19412 | 2025-07-08 08:43:21 |
| - | 4303943_MatoSpectoru_carmelita_fox_fanart_poll_fullcolor_nude_f1.png | 714166 | 2025-07-08 08:43:21 |
| - | 4303945_MatoSpectoru_carmelita_fox_fanart_poll_fullcolor_nude_f1c.json | 19412 | 2025-07-08 08:43:22 |
| - | 4303945_MatoSpectoru_carmelita_fox_fanart_poll_fullcolor_nude_f1c.png | 772516 | 2025-07-08 08:43:22 |
| - | 4303948_MatoSpectoru_carmelita_fox_fanart_poll_fullcolor_suit_f1.json | 19412 | 2025-07-08 08:43:20 |
| - | 4303948_MatoSpectoru_carmelita_fox_fanart_poll_fullcolor_suit_f1.png | 727269 | 2025-07-08 08:43:20 |
| - | 4303949_MatoSpectoru_carmelita_fox_fanart_poll_fullcolor_suit_f1n.json | 19412 | 2025-07-08 08:43:21 |
| - | 4303949_MatoSpectoru_carmelita_fox_fanart_poll_fullcolor_suit_f1n.png | 728866 | 2025-07-08 08:43:21 |
| - | 4303953_MatoSpectoru_carmelita_fox_fanart_poll_fullcolor_suit_f1t.json | 19412 | 2025-07-08 08:43:21 |
| - | 4303953_MatoSpectoru_carmelita_fox_fanart_poll_fullcolor_suit_f1t.png | 734944 | 2025-07-08 08:43:21 |
| - | 4303959_MatoSpectoru_rouge_x_vanilla_comm_2022_fullcolor_f1.json | 19011 | 2025-07-08 08:43:01 |
| - | 4303959_MatoSpectoru_rouge_x_vanilla_comm_2022_fullcolor_f1.png | 504582 | 2025-07-08 08:43:01 |
| - | 4303960_MatoSpectoru_rouge_x_vanilla_comm_2022_fullcolor_f3.json | 19011 | 2025-07-08 08:43:02 |
| - | 4303960_MatoSpectoru_rouge_x_vanilla_comm_2022_fullcolor_f3.png | 516002 | 2025-07-08 08:43:02 |
| - | 4303962_MatoSpectoru_rouge_x_vanilla_comm_2022_fullcolor_f3c.json | 19011 | 2025-07-08 08:43:02 |
| - | 4303962_MatoSpectoru_rouge_x_vanilla_comm_2022_fullcolor_f3c.png | 522608 | 2025-07-08 08:43:02 |
| - | 4303964_MatoSpectoru_rouge_x_vanilla_comm_2022_fullcolor_f3t.json | 19011 | 2025-07-08 08:43:01 |
| - | 4303964_MatoSpectoru_rouge_x_vanilla_comm_2022_fullcolor_f3t.png | 540680 | 2025-07-08 08:43:01 |
| - | 4303968_MatoSpectoru_meowscarada_fanart_poll_fullcolor_f1.json | 18264 | 2025-07-08 08:42:59 |
| - | 4303968_MatoSpectoru_meowscarada_fanart_poll_fullcolor_f1.png | 576651 | 2025-07-08 08:42:59 |
| - | 4303970_MatoSpectoru_meowscarada_fanart_poll_fullcolor_f1b.json | 18264 | 2025-07-08 08:42:59 |
| - | 4303970_MatoSpectoru_meowscarada_fanart_poll_fullcolor_f1b.png | 587647 | 2025-07-08 08:42:59 |
| - | 4303971_MatoSpectoru_meowscarada_fanart_poll_fullcolor_f1t.json | 18264 | 2025-07-08 08:42:59 |
| - | 4303971_MatoSpectoru_meowscarada_fanart_poll_fullcolor_f1t.png | 579341 | 2025-07-08 08:42:59 |
| - | 4303972_MatoSpectoru_meowscarada_fanart_poll_fullcolor_f2.json | 18264 | 2025-07-08 08:43:00 |
| - | 4303972_MatoSpectoru_meowscarada_fanart_poll_fullcolor_f2.png | 590371 | 2025-07-08 08:43:00 |
| - | 4303974_MatoSpectoru_meowscarada_fanart_poll_fullcolor_f2b.json | 18264 | 2025-07-08 08:43:00 |
| - | 4303974_MatoSpectoru_meowscarada_fanart_poll_fullcolor_f2b.png | 595818 | 2025-07-08 08:43:00 |
| - | 4304837_MatoSpectoru_toriel_anim_dith_mr_f.gif | 646313 | 2025-07-08 08:37:25 |
| - | 4304837_MatoSpectoru_toriel_anim_dith_mr_f.json | 9992 | 2025-07-08 08:37:25 |
| - | 4307641_MatoSpectoru_coco_butt_anim_540p_lr.gif | 18010477 | 2025-07-08 08:07:34 |
| - | 4307641_MatoSpectoru_coco_butt_anim_540p_lr.json | 12630 | 2025-07-08 08:07:34 |
| - | 4315666_MatoSpectoru_coco_butt_no_crash_anim_540p_lr.gif | 18616671 | 2025-07-08 08:07:34 |
| - | 4315666_MatoSpectoru_coco_butt_no_crash_anim_540p_lr.json | 12630 | 2025-07-08 08:07:34 |
| - | 4420752_MatoSpectoru_nicole_sonic_comm_fullcolor_f1t.json | 13607 | 2025-07-05 18:27:58 |
| - | 4420752_MatoSpectoru_nicole_sonic_comm_fullcolor_f1t.png | 579031 | 2025-07-05 18:27:58 |
| - | 4420756_MatoSpectoru_nicole_sonic_comm_fullcolor_f1.json | 13607 | 2025-07-05 18:27:58 |
| - | 4420756_MatoSpectoru_nicole_sonic_comm_fullcolor_f1.png | 548341 | 2025-07-05 18:27:58 |
| - | 4420758_MatoSpectoru_nicole_sonic_comm_fullcolor_f2.json | 13607 | 2025-07-05 18:27:59 |
| - | 4420758_MatoSpectoru_nicole_sonic_comm_fullcolor_f2.png | 553464 | 2025-07-05 18:27:59 |
| - | 4420759_MatoSpectoru_cleopatra_ms_comm_fullcolor_original.json | 11379 | 2025-07-05 18:27:54 |
| - | 4420759_MatoSpectoru_cleopatra_ms_comm_fullcolor_original.png | 542900 | 2025-07-05 18:27:54 |
| - | 4420760_MatoSpectoru_cleopatra_ms_comm_fullcolor_nude.json | 11379 | 2025-07-05 18:27:54 |
| - | 4420760_MatoSpectoru_cleopatra_ms_comm_fullcolor_nude.png | 457734 | 2025-07-05 18:27:54 |
| - | 4420762_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_suit_f1_text.json | 21825 | 2025-07-05 18:27:51 |
| - | 4420762_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_suit_f1_text.png | 755080 | 2025-07-05 18:27:51 |
| - | 4420764_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_suit_f1.json | 21825 | 2025-07-05 18:27:51 |
| - | 4420764_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_suit_f1.png | 751256 | 2025-07-05 18:27:51 |
| - | 4420766_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_suit_f1pb.json | 21825 | 2025-07-05 18:27:51 |
| - | 4420766_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_suit_f1pb.png | 788505 | 2025-07-05 18:27:51 |
| - | 4420767_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_suit_f1pbc.json | 21825 | 2025-07-05 18:27:51 |
| - | 4420767_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_suit_f1pbc.png | 1110788 | 2025-07-05 18:27:51 |
| - | 4420768_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_nude_f1.json | 21825 | 2025-07-05 18:27:52 |
| - | 4420768_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_nude_f1.png | 774419 | 2025-07-05 18:27:52 |
| - | 4420769_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_nude_f1pb.json | 21825 | 2025-07-05 18:27:52 |
| - | 4420769_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_nude_f1pb.png | 812135 | 2025-07-05 18:27:52 |
| - | 4420770_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_nude_f1pbc.json | 21825 | 2025-07-05 18:27:52 |
| - | 4420770_MatoSpectoru_tsukino_mh_fanart_poll_fullcolor_nude_f1pbc.png | 816404 | 2025-07-05 18:27:52 |
| - | 4420771_MatoSpectoru_tristana_fullcolor_f1.json | 14993 | 2025-07-05 18:27:48 |
| - | 4420771_MatoSpectoru_tristana_fullcolor_f1.png | 547469 | 2025-07-05 18:27:48 |
| - | 4420772_MatoSpectoru_tristana_fullcolor_f2_sw_t.json | 14993 | 2025-07-05 18:27:48 |
| - | 4420772_MatoSpectoru_tristana_fullcolor_f2_sw_t.png | 622879 | 2025-07-05 18:27:48 |
| - | 4420773_MatoSpectoru_tristana_fullcolor_f3nst.json | 14993 | 2025-07-05 18:27:48 |
| - | 4420773_MatoSpectoru_tristana_fullcolor_f3nst.png | 607106 | 2025-07-05 18:27:48 |
| - | 4420776_MatoSpectoru_tristana_fullcolor_f3ns_pt.json | 14993 | 2025-07-05 18:27:48 |
| - | 4420776_MatoSpectoru_tristana_fullcolor_f3ns_pt.png | 709810 | 2025-07-05 18:27:48 |
| - | 4420778_MatoSpectoru_roomi_gf_comm_fullcolor_f1at.json | 22551 | 2025-07-05 18:27:43 |
| - | 4420778_MatoSpectoru_roomi_gf_comm_fullcolor_f1at.png | 447127 | 2025-07-05 18:27:43 |
| - | 4420779_MatoSpectoru_roomi_gf_comm_fullcolor_f1atd.json | 22551 | 2025-07-05 18:27:43 |
| - | 4420779_MatoSpectoru_roomi_gf_comm_fullcolor_f1atd.png | 462529 | 2025-07-05 18:27:43 |
| - | 4420780_MatoSpectoru_roomi_gf_comm_fullcolor_f2ant.json | 22551 | 2025-07-05 18:27:44 |
| - | 4420780_MatoSpectoru_roomi_gf_comm_fullcolor_f2ant.png | 490248 | 2025-07-05 18:27:44 |
| - | 4420781_MatoSpectoru_roomi_gf_comm_fullcolor_f2at.json | 22551 | 2025-07-05 18:27:43 |
| - | 4420781_MatoSpectoru_roomi_gf_comm_fullcolor_f2at.png | 478169 | 2025-07-05 18:27:43 |
| - | 4420784_MatoSpectoru_roomi_gf_comm_fullcolor_f2tb.json | 22551 | 2025-07-05 18:27:44 |
| - | 4420784_MatoSpectoru_roomi_gf_comm_fullcolor_f2tb.png | 490130 | 2025-07-05 18:27:44 |
| - | 4420785_MatoSpectoru_roomi_gf_comm_fullcolor_f4ant.json | 22551 | 2025-07-05 18:27:44 |
| - | 4420785_MatoSpectoru_roomi_gf_comm_fullcolor_f4ant.png | 479676 | 2025-07-05 18:27:44 |
| - | 4420786_MatoSpectoru_roomi_gf_comm_fullcolor_f4at.json | 22551 | 2025-07-05 18:27:44 |
| - | 4420786_MatoSpectoru_roomi_gf_comm_fullcolor_f4at.png | 469118 | 2025-07-05 18:27:44 |
| - | 4420787_MatoSpectoru_roomi_gf_comm_fullcolor_f5at.json | 22551 | 2025-07-05 18:27:45 |
| - | 4420787_MatoSpectoru_roomi_gf_comm_fullcolor_f5at.png | 466257 | 2025-07-05 18:27:45 |
| - | 4420790_MatoSpectoru_ankha_ac_comm_fullcolor_f1.json | 14721 | 2025-07-05 18:27:38 |
| - | 4420790_MatoSpectoru_ankha_ac_comm_fullcolor_f1.png | 542009 | 2025-07-05 18:27:38 |
| - | 4420791_MatoSpectoru_ankha_ac_comm_fullcolor_f1t.json | 14721 | 2025-07-05 18:27:39 |
| - | 4420791_MatoSpectoru_ankha_ac_comm_fullcolor_f1t.png | 559268 | 2025-07-05 18:27:39 |
| - | 4420792_MatoSpectoru_ankha_ac_comm_fullcolor_f2.json | 14721 | 2025-07-05 18:27:39 |
| - | 4420792_MatoSpectoru_ankha_ac_comm_fullcolor_f2.png | 654863 | 2025-07-05 18:27:39 |
| - | 4420793_MatoSpectoru_ankha_ac_comm_fullcolor_f2c.json | 14721 | 2025-07-05 18:27:39 |
| - | 4420793_MatoSpectoru_ankha_ac_comm_fullcolor_f2c.png | 692459 | 2025-07-05 18:27:39 |
| - | 4420798_MatoSpectoru_midna_2023_comm_fullcolor_f1a.json | 20291 | 2025-07-05 18:27:33 |
| - | 4420798_MatoSpectoru_midna_2023_comm_fullcolor_f1a.png | 870761 | 2025-07-05 18:27:33 |
| - | 4420799_MatoSpectoru_midna_2023_comm_fullcolor_f2a.json | 20291 | 2025-07-05 18:27:33 |
| - | 4420799_MatoSpectoru_midna_2023_comm_fullcolor_f2a.png | 875459 | 2025-07-05 18:27:33 |
| - | 4420800_MatoSpectoru_midna_2023_comm_fullcolor_f2ca_text.json | 20291 | 2025-07-05 18:27:33 |
| - | 4420800_MatoSpectoru_midna_2023_comm_fullcolor_f2ca_text.png | 889497 | 2025-07-05 18:27:33 |
| - | 4420801_MatoSpectoru_midna_2023_comm_fullcolor_f3a.json | 20291 | 2025-07-05 18:27:34 |
| - | 4420801_MatoSpectoru_midna_2023_comm_fullcolor_f3a.png | 863161 | 2025-07-05 18:27:34 |
| - | 4420802_MatoSpectoru_midna_2023_comm_fullcolor_f3ca.json | 20291 | 2025-07-05 18:27:34 |
| - | 4420802_MatoSpectoru_midna_2023_comm_fullcolor_f3ca.png | 926268 | 2025-07-05 18:27:34 |
| - | 4420803_MatoSpectoru_midna_2023_comm_fullcolor_f3ca_text.json | 20291 | 2025-07-05 18:27:34 |
| - | 4420803_MatoSpectoru_midna_2023_comm_fullcolor_f3ca_text.png | 933963 | 2025-07-05 18:27:34 |
| - | 4420809_MatoSpectoru_midna_2023_comm_2_fullcolor_f1a.json | 18038 | 2025-07-05 18:27:27 |
| - | 4420809_MatoSpectoru_midna_2023_comm_2_fullcolor_f1a.png | 739619 | 2025-07-05 18:27:27 |
| - | 4420810_MatoSpectoru_midna_2023_comm_2_fullcolor_f1a_text.json | 18038 | 2025-07-05 18:27:27 |
| - | 4420810_MatoSpectoru_midna_2023_comm_2_fullcolor_f1a_text.png | 780663 | 2025-07-05 18:27:27 |
| - | 4420811_MatoSpectoru_midna_2023_comm_2_fullcolor_f2a.json | 18038 | 2025-07-05 18:27:27 |
| - | 4420811_MatoSpectoru_midna_2023_comm_2_fullcolor_f2a.png | 750023 | 2025-07-05 18:27:27 |
| - | 4420812_MatoSpectoru_midna_2023_comm_2_fullcolor_f3a.json | 18038 | 2025-07-05 18:27:28 |
| - | 4420812_MatoSpectoru_midna_2023_comm_2_fullcolor_f3a.png | 967664 | 2025-07-05 18:27:28 |
| - | 4420815_MatoSpectoru_midna_2023_comm_2_fullcolor_f3a_text.json | 18038 | 2025-07-05 18:27:28 |
| - | 4420815_MatoSpectoru_midna_2023_comm_2_fullcolor_f3a_text.png | 1028677 | 2025-07-05 18:27:28 |
| - | 4420817_MatoSpectoru_jenny_xj9_comm_flatcolor_f1_t.json | 11178 | 2025-07-05 18:27:22 |
| - | 4420817_MatoSpectoru_jenny_xj9_comm_flatcolor_f1_t.png | 628582 | 2025-07-05 18:27:22 |
| - | 4420818_MatoSpectoru_jenny_xj9_comm_flatcolor_f1.json | 11178 | 2025-07-05 18:27:23 |
| - | 4420818_MatoSpectoru_jenny_xj9_comm_flatcolor_f1.png | 628360 | 2025-07-05 18:27:23 |
| - | 4420823_MatoSpectoru_anim_gwen_martin_xlr.gif | 2930216 | 2025-07-05 18:27:16 |
| - | 4420823_MatoSpectoru_anim_gwen_martin_xlr.json | 8040 | 2025-07-05 18:27:16 |
| - | 4420855_MatoSpectoru_tsukino_mh_fullcolor_f1t.json | 10913 | 2025-07-05 18:26:56 |
| - | 4420855_MatoSpectoru_tsukino_mh_fullcolor_f1t.png | 574071 | 2025-07-05 18:26:56 |
| - | 4420857_MatoSpectoru_tsukino_mh_fullcolor_f1.json | 10913 | 2025-07-05 18:26:56 |
| - | 4420857_MatoSpectoru_tsukino_mh_fullcolor_f1.png | 533750 | 2025-07-05 18:26:56 |
| - | 4421074_MatoSpectoru_princess_bubblegum_f2.json | 8574 | 2025-07-05 18:24:44 |
| - | 4421074_MatoSpectoru_princess_bubblegum_f2.png | 596590 | 2025-07-05 18:24:44 |
| - | 4421109_MatoSpectoru_princess_bubblegum_2_f1.json | 11419 | 2025-07-05 18:24:25 |
| - | 4421109_MatoSpectoru_princess_bubblegum_2_f1.png | 686587 | 2025-07-05 18:24:25 |
| - | 4421111_MatoSpectoru_princess_bubblegum_2_f2.json | 11419 | 2025-07-05 18:24:25 |
| - | 4421111_MatoSpectoru_princess_bubblegum_2_f2.png | 691096 | 2025-07-05 18:24:25 |
| - | 4421117_MatoSpectoru_vanilla_comm_fullcolor_f2.json | 13834 | 2025-07-05 18:24:19 |
| - | 4421117_MatoSpectoru_vanilla_comm_fullcolor_f2.png | 558432 | 2025-07-05 18:24:19 |
| - | 4421119_MatoSpectoru_vanilla_comm_fullcolor_f2b.json | 13834 | 2025-07-05 18:24:20 |
| - | 4421119_MatoSpectoru_vanilla_comm_fullcolor_f2b.png | 569857 | 2025-07-05 18:24:20 |
| - | 4421120_MatoSpectoru_vanilla_comm_fullcolor_f2c.json | 13834 | 2025-07-05 18:24:20 |
| - | 4421120_MatoSpectoru_vanilla_comm_fullcolor_f2c.png | 578242 | 2025-07-05 18:24:20 |
| - | 4421123_MatoSpectoru_lanolin_sheep_sonic_fanart_poll_fullcolor_f1.json | 15719 | 2025-07-05 18:24:16 |
| - | 4421123_MatoSpectoru_lanolin_sheep_sonic_fanart_poll_fullcolor_f1.png | 555829 | 2025-07-05 18:24:16 |
| - | 4421124_MatoSpectoru_lanolin_sheep_sonic_fanart_poll_fullcolor_f1t.json | 15719 | 2025-07-05 18:24:16 |
| - | 4421124_MatoSpectoru_lanolin_sheep_sonic_fanart_poll_fullcolor_f1t.png | 564797 | 2025-07-05 18:24:16 |
| - | 4421125_MatoSpectoru_lanolin_sheep_sonic_fanart_poll_fullcolor_f2b.json | 15719 | 2025-07-05 18:24:16 |
| - | 4421125_MatoSpectoru_lanolin_sheep_sonic_fanart_poll_fullcolor_f2b.png | 574680 | 2025-07-05 18:24:16 |
| - | 4421126_MatoSpectoru_lanolin_sheep_sonic_fanart_poll_fullcolor_f2bc.json | 15719 | 2025-07-05 18:24:16 |
| - | 4421126_MatoSpectoru_lanolin_sheep_sonic_fanart_poll_fullcolor_f2bc.png | 588281 | 2025-07-05 18:24:16 |
| - | 4439446_MatoSpectoru_rouge_talk_anim_demo_c.gif | 9135633 | 2025-07-05 15:33:51 |
| - | 4439446_MatoSpectoru_rouge_talk_anim_demo_c.json | 8452 | 2025-07-05 15:33:51 |
| - | 4439457_MatoSpectoru_nikki_fennekin_oc_comm_fullcolor_f1t.json | 14184 | 2025-07-05 15:33:46 |
| - | 4439457_MatoSpectoru_nikki_fennekin_oc_comm_fullcolor_f1t.png | 579786 | 2025-07-05 15:33:46 |
| - | 4439458_MatoSpectoru_nikki_fennekin_oc_comm_fullcolor_f1.json | 14184 | 2025-07-05 15:33:46 |
| - | 4439458_MatoSpectoru_nikki_fennekin_oc_comm_fullcolor_f1.png | 557121 | 2025-07-05 15:33:46 |
| - | 4439459_MatoSpectoru_nikki_fennekin_oc_comm_fullcolor_f2.json | 14184 | 2025-07-05 15:33:46 |
| - | 4439459_MatoSpectoru_nikki_fennekin_oc_comm_fullcolor_f2.png | 637652 | 2025-07-05 15:33:46 |
| - | 4441221_MatoSpectoru_nicole_watterson_anim_fullcolor_logo_720f_crop.gif | 13243059 | 2025-07-05 15:18:59 |
| - | 4441221_MatoSpectoru_nicole_watterson_anim_fullcolor_logo_720f_crop.json | 8909 | 2025-07-05 15:18:59 |
| - | 4613764_MatoSpectoru_vex_lol_fullcolor_f1.json | 13415 | 2025-07-03 16:44:32 |
| - | 4613764_MatoSpectoru_vex_lol_fullcolor_f1.png | 758496 | 2025-07-03 16:44:32 |
| - | 4613766_MatoSpectoru_vex_lol_fullcolor_f1t.json | 13415 | 2025-07-03 16:44:31 |
| - | 4613766_MatoSpectoru_vex_lol_fullcolor_f1t.png | 771283 | 2025-07-03 16:44:31 |
| - | 4613767_MatoSpectoru_vex_lol_fullcolor_f2.json | 13415 | 2025-07-03 16:44:32 |
| - | 4613767_MatoSpectoru_vex_lol_fullcolor_f2.png | 771414 | 2025-07-03 16:44:32 |
| - | 4614140_MatoSpectoru_taokaka_fullcolor_f1s.json | 12994 | 2025-07-03 16:39:15 |
| - | 4614140_MatoSpectoru_taokaka_fullcolor_f1s.png | 979249 | 2025-07-03 16:39:15 |
| - | 4614141_MatoSpectoru_taokaka_fullcolor_f2bs.json | 12994 | 2025-07-03 16:39:16 |
| - | 4614141_MatoSpectoru_taokaka_fullcolor_f2bs.png | 989400 | 2025-07-03 16:39:16 |
| - | 4614142_MatoSpectoru_taokaka_fullcolor_f2s.json | 12994 | 2025-07-03 16:39:16 |
| - | 4614142_MatoSpectoru_taokaka_fullcolor_f2s.png | 983857 | 2025-07-03 16:39:16 |
| - | 4614192_MatoSpectoru_toriel_book_fullcolor_f1.json | 17178 | 2025-07-03 16:38:13 |
| - | 4614192_MatoSpectoru_toriel_book_fullcolor_f1.png | 897247 | 2025-07-03 16:38:13 |
| - | 4614193_MatoSpectoru_toriel_book_fullcolor_f1b.json | 17178 | 2025-07-03 16:38:15 |
| - | 4614193_MatoSpectoru_toriel_book_fullcolor_f1b.png | 927903 | 2025-07-03 16:38:15 |
| - | 4614195_MatoSpectoru_toriel_book_fullcolor_f1bgl.json | 17178 | 2025-07-03 16:38:16 |
| - | 4614195_MatoSpectoru_toriel_book_fullcolor_f1bgl.png | 939423 | 2025-07-03 16:38:16 |
| - | 4614197_MatoSpectoru_toriel_book_fullcolor_f1gl.json | 17178 | 2025-07-03 16:38:15 |
| - | 4614197_MatoSpectoru_toriel_book_fullcolor_f1gl.png | 908748 | 2025-07-03 16:38:15 |
| - | 4614198_MatoSpectoru_toriel_book_fullcolor_f1t.json | 17178 | 2025-07-03 16:38:13 |
| - | 4614198_MatoSpectoru_toriel_book_fullcolor_f1t.png | 877484 | 2025-07-03 16:38:13 |
| - | 4614222_MatoSpectoru_lien-da_sonic_comm_fullcolor_f1.json | 17985 | 2025-07-03 16:37:43 |
| - | 4614222_MatoSpectoru_lien-da_sonic_comm_fullcolor_f1.png | 451035 | 2025-07-03 16:37:43 |
| - | 4614223_MatoSpectoru_lien-da_sonic_comm_fullcolor_f1b.json | 17985 | 2025-07-03 16:37:43 |
| - | 4614223_MatoSpectoru_lien-da_sonic_comm_fullcolor_f1b.png | 468187 | 2025-07-03 16:37:43 |
| - | 4614224_MatoSpectoru_lien-da_sonic_comm_fullcolor_f1t.json | 17985 | 2025-07-03 16:37:43 |
| - | 4614224_MatoSpectoru_lien-da_sonic_comm_fullcolor_f1t.png | 487121 | 2025-07-03 16:37:43 |
| - | 4614225_MatoSpectoru_lien-da_sonic_comm_fullcolor_f2.json | 17985 | 2025-07-03 16:37:43 |
| - | 4614225_MatoSpectoru_lien-da_sonic_comm_fullcolor_f2.png | 479553 | 2025-07-03 16:37:43 |
| - | 4614226_MatoSpectoru_lien-da_sonic_comm_fullcolor_f2t.json | 17985 | 2025-07-03 16:37:43 |
| - | 4614226_MatoSpectoru_lien-da_sonic_comm_fullcolor_f2t.png | 522068 | 2025-07-03 16:37:43 |
| - | 4614234_MatoSpectoru_bianca_fanart_poll_may_2023_fullcolor_f1t.json | 13622 | 2025-07-03 16:37:37 |
| - | 4614234_MatoSpectoru_bianca_fanart_poll_may_2023_fullcolor_f1t.png | 801929 | 2025-07-03 16:37:37 |
| - | 4614235_MatoSpectoru_bianca_fanart_poll_may_2023_fullcolor_f2.json | 13622 | 2025-07-03 16:37:37 |
| - | 4614235_MatoSpectoru_bianca_fanart_poll_may_2023_fullcolor_f2.png | 800795 | 2025-07-03 16:37:37 |
| - | 4614238_MatoSpectoru_bianca_fanart_poll_may_2023_fullcolor_f3b.json | 13622 | 2025-07-03 16:37:37 |
| - | 4614238_MatoSpectoru_bianca_fanart_poll_may_2023_fullcolor_f3b.png | 768186 | 2025-07-03 16:37:37 |
| - | 4614273_MatoSpectoru_midnah_fullcolor_f1.json | 20690 | 2025-07-03 16:37:16 |
| - | 4614273_MatoSpectoru_midnah_fullcolor_f1.png | 547070 | 2025-07-03 16:37:16 |
| - | 4614274_MatoSpectoru_midnah_fullcolor_f3b.json | 20690 | 2025-07-03 16:37:17 |
| - | 4614274_MatoSpectoru_midnah_fullcolor_f3b.png | 494596 | 2025-07-03 16:37:17 |
| - | 4614275_MatoSpectoru_midnah_fullcolor_f6.json | 20690 | 2025-07-03 16:37:18 |
| - | 4614275_MatoSpectoru_midnah_fullcolor_f6.png | 504197 | 2025-07-03 16:37:18 |
| - | 4614276_MatoSpectoru_midnah_fullcolor_f6b.json | 20690 | 2025-07-03 16:37:18 |
| - | 4614276_MatoSpectoru_midnah_fullcolor_f6b.png | 488537 | 2025-07-03 16:37:18 |
| - | 4614278_MatoSpectoru_midnah_fullcolor_f6c.json | 20690 | 2025-07-03 16:37:17 |
| - | 4614278_MatoSpectoru_midnah_fullcolor_f6c.png | 502509 | 2025-07-03 16:37:17 |
| - | 4614279_MatoSpectoru_midnah_fullcolor_f6d.json | 20690 | 2025-07-03 16:37:18 |
| - | 4614279_MatoSpectoru_midnah_fullcolor_f6d.png | 486796 | 2025-07-03 16:37:18 |
| - | 4614281_MatoSpectoru_midnah_fullcolor_f3.json | 20690 | 2025-07-03 16:37:17 |
| - | 4614281_MatoSpectoru_midnah_fullcolor_f3.png | 510361 | 2025-07-03 16:37:17 |
| - | 4614288_MatoSpectoru_loona_comm_fullcolor_f1.json | 13258 | 2025-07-03 16:37:10 |
| - | 4614288_MatoSpectoru_loona_comm_fullcolor_f1.png | 624229 | 2025-07-03 16:37:10 |
| - | 4614289_MatoSpectoru_loona_comm_fullcolor_f1cm.json | 13258 | 2025-07-03 16:37:11 |
| - | 4614289_MatoSpectoru_loona_comm_fullcolor_f1cm.png | 742801 | 2025-07-03 16:37:11 |
| - | 4614290_MatoSpectoru_loona_comm_fullcolor_f1t.json | 13258 | 2025-07-03 16:37:11 |
| - | 4614290_MatoSpectoru_loona_comm_fullcolor_f1t.png | 640069 | 2025-07-03 16:37:11 |
| - | 4614462_MatoSpectoru_poppy_lol_fullcolor_f3_bg.json | 17861 | 2025-07-03 16:35:34 |
| - | 4614462_MatoSpectoru_poppy_lol_fullcolor_f3_bg.png | 854924 | 2025-07-03 16:35:34 |
| - | 4614463_MatoSpectoru_poppy_lol_fullcolor_f3_bg_t.json | 17861 | 2025-07-03 16:35:34 |
| - | 4614463_MatoSpectoru_poppy_lol_fullcolor_f3_bg_t.png | 867136 | 2025-07-03 16:35:34 |
| - | 4614465_MatoSpectoru_poppy_lol_fullcolor_f4_bg.json | 17861 | 2025-07-03 16:35:34 |
| - | 4614465_MatoSpectoru_poppy_lol_fullcolor_f4_bg.png | 889267 | 2025-07-03 16:35:34 |
| - | 4614466_MatoSpectoru_poppy_lol_fullcolor_f4_cm_bg.json | 17861 | 2025-07-03 16:35:34 |
| - | 4614466_MatoSpectoru_poppy_lol_fullcolor_f4_cm_bg.png | 866073 | 2025-07-03 16:35:34 |
| - | 4614468_MatoSpectoru_poppy_lol_fullcolor_f4_cmc_bg.json | 17861 | 2025-07-03 16:35:35 |
| - | 4614468_MatoSpectoru_poppy_lol_fullcolor_f4_cmc_bg.png | 908720 | 2025-07-03 16:35:35 |
| - | 4614487_MatoSpectoru_tristana_comm_fullcolor_at.json | 12392 | 2025-07-03 16:35:22 |
| - | 4614487_MatoSpectoru_tristana_comm_fullcolor_at.png | 778829 | 2025-07-03 16:35:22 |
| - | 4614488_MatoSpectoru_tristana_comm_fullcolor_f1.json | 12392 | 2025-07-03 16:35:22 |
| - | 4614488_MatoSpectoru_tristana_comm_fullcolor_f1.png | 767494 | 2025-07-03 16:35:22 |
| - | 4614491_MatoSpectoru_tristana_comm_fullcolor_milk.json | 12392 | 2025-07-03 16:35:22 |
| - | 4614491_MatoSpectoru_tristana_comm_fullcolor_milk.png | 811045 | 2025-07-03 16:35:22 |
| - | 4614497_MatoSpectoru_rkr_fullcolor_f.json | 10539 | 2025-07-03 16:35:11 |
| - | 4614497_MatoSpectoru_rkr_fullcolor_f.png | 941838 | 2025-07-03 16:35:11 |
| - | 4614498_MatoSpectoru_rkr_fullcolor_fsw.json | 10539 | 2025-07-03 16:35:11 |
| - | 4614498_MatoSpectoru_rkr_fullcolor_fsw.png | 972785 | 2025-07-03 16:35:11 |
| - | 4614501_MatoSpectoru_rkr_fullcolor_m.json | 10535 | 2025-07-03 16:35:08 |
| - | 4614501_MatoSpectoru_rkr_fullcolor_m.png | 1005647 | 2025-07-03 16:35:08 |
| - | 4614502_MatoSpectoru_rkr_fullcolor_msw.json | 10535 | 2025-07-03 16:35:08 |
| - | 4614502_MatoSpectoru_rkr_fullcolor_msw.png | 1028544 | 2025-07-03 16:35:08 |
| - | 4614505_MatoSpectoru_acbrn_1_.json | 10448 | 2025-07-03 16:35:06 |
| - | 4614505_MatoSpectoru_acbrn_1_.png | 829980 | 2025-07-03 16:35:06 |
| - | 4614506_MatoSpectoru_acbrn_2_.json | 10448 | 2025-07-03 16:35:07 |
| - | 4614506_MatoSpectoru_acbrn_2_.png | 1444444 | 2025-07-03 16:35:07 |
| - | 4614508_MatoSpectoru_acbrn_3_.json | 10989 | 2025-07-03 16:35:04 |
| - | 4614508_MatoSpectoru_acbrn_3_.png | 1450665 | 2025-07-03 16:35:04 |
| - | 4614509_MatoSpectoru_acbrn_4_.json | 10989 | 2025-07-03 16:35:05 |
| - | 4614509_MatoSpectoru_acbrn_4_.png | 1454160 | 2025-07-03 16:35:05 |
| - | 4621781_MatoSpectoru_matospectoru_comms_2023_c_fa_inkbunny_mr.json | 13471 | 2025-07-03 15:11:09 |
| - | 4621781_MatoSpectoru_matospectoru_comms_2023_c_fa_inkbunny_mr.png | 2209239 | 2025-07-03 15:11:09 |
| - | 4641904_MatoSpectoru_niki_x_selene_oc_comm_fullcolor_nude_f1f.json | 14294 | 2025-07-03 11:26:42 |
| - | 4641904_MatoSpectoru_niki_x_selene_oc_comm_fullcolor_nude_f1f.png | 1269369 | 2025-07-03 11:26:42 |
| - | 4641905_MatoSpectoru_niki_x_selene_oc_comm_fullcolor_suit_f1ft.json | 14294 | 2025-07-03 11:26:41 |
| - | 4641905_MatoSpectoru_niki_x_selene_oc_comm_fullcolor_suit_f1ft.png | 1567632 | 2025-07-03 11:26:41 |
| - | 4641906_MatoSpectoru_niki_x_selene_oc_comm_fullcolor_suit_f2f.json | 14294 | 2025-07-03 11:26:42 |
| - | 4641906_MatoSpectoru_niki_x_selene_oc_comm_fullcolor_suit_f2f.png | 1421049 | 2025-07-03 11:26:42 |
| - | 4641911_MatoSpectoru_scormidna_oc_comm_fullcolor_logo.json | 10577 | 2025-07-03 11:26:32 |
| - | 4641911_MatoSpectoru_scormidna_oc_comm_fullcolor_logo.png | 639136 | 2025-07-03 11:26:32 |
| - | 4641912_MatoSpectoru_scormidna_oc_comm_fullcolor_t_logo.json | 10577 | 2025-07-03 11:26:32 |
| - | 4641912_MatoSpectoru_scormidna_oc_comm_fullcolor_t_logo.png | 731749 | 2025-07-03 11:26:32 |
| - | 4641916_MatoSpectoru_togeki_kelly_oc_comm_fullcolor_f1t_logo.json | 7306 | 2025-07-03 11:26:28 |
| - | 4641916_MatoSpectoru_togeki_kelly_oc_comm_fullcolor_f1t_logo.png | 832187 | 2025-07-03 11:26:28 |
| - | 4641923_MatoSpectoru_rebecca_alexandrite_reshiram_oc_comm_fullcolor_f1_logo.json | 13506 | 2025-07-03 11:26:24 |
| - | 4641923_MatoSpectoru_rebecca_alexandrite_reshiram_oc_comm_fullcolor_f1_logo.png | 1825286 | 2025-07-03 11:26:24 |
| - | 4641924_MatoSpectoru_rebecca_alexandrite_reshiram_oc_comm_fullcolor_f1_text_logo.json | 13506 | 2025-07-03 11:26:24 |
| - | 4641924_MatoSpectoru_rebecca_alexandrite_reshiram_oc_comm_fullcolor_f1_text_logo.png | 1854398 | 2025-07-03 11:26:24 |
| - | 4641926_MatoSpectoru_rebecca_alexandrite_reshiram_oc_comm_fullcolor_f2_logo.json | 13506 | 2025-07-03 11:26:24 |
| - | 4641926_MatoSpectoru_rebecca_alexandrite_reshiram_oc_comm_fullcolor_f2_logo.png | 1836636 | 2025-07-03 11:26:24 |
| - | 4641933_MatoSpectoru_jasmine_oc_comm_fullcolor_nude_f1_logo.json | 11982 | 2025-07-03 11:26:15 |
| - | 4641933_MatoSpectoru_jasmine_oc_comm_fullcolor_nude_f1_logo.png | 1379705 | 2025-07-03 11:26:15 |
| - | 4641934_MatoSpectoru_jasmine_oc_comm_fullcolor_nude_f2_logo.json | 11982 | 2025-07-03 11:26:16 |
| - | 4641934_MatoSpectoru_jasmine_oc_comm_fullcolor_nude_f2_logo.png | 1425416 | 2025-07-03 11:26:16 |
| - | 4641935_MatoSpectoru_jasmine_oc_comm_fullcolor_suit_f1_logo.json | 11982 | 2025-07-03 11:26:15 |
| - | 4641935_MatoSpectoru_jasmine_oc_comm_fullcolor_suit_f1_logo.png | 1372177 | 2025-07-03 11:26:15 |
| - | 4641951_MatoSpectoru_lily_oc_comm_flatcolor_f1.json | 13788 | 2025-07-03 11:26:02 |
| - | 4641951_MatoSpectoru_lily_oc_comm_flatcolor_f1.png | 485919 | 2025-07-03 11:26:02 |
| - | 4641954_MatoSpectoru_lily_oc_comm_flatcolor_f2.json | 13788 | 2025-07-03 11:26:02 |
| - | 4641954_MatoSpectoru_lily_oc_comm_flatcolor_f2.png | 541629 | 2025-07-03 11:26:02 |
| - | 4641958_MatoSpectoru_lily_oc_comm_flatcolor_f2t.json | 13788 | 2025-07-03 11:26:02 |
| - | 4641958_MatoSpectoru_lily_oc_comm_flatcolor_f2t.png | 590896 | 2025-07-03 11:26:02 |
| - | 4664454_MatoSpectoru_meow_skulls_fullcolor_ff1t_logo.json | 12880 | 2025-07-03 07:34:13 |
| - | 4664454_MatoSpectoru_meow_skulls_fullcolor_ff1t_logo.png | 1877585 | 2025-07-03 07:34:13 |
| - | 4664456_MatoSpectoru_meow_skulls_fullcolor_ff1sw_logo.json | 12880 | 2025-07-03 07:34:14 |
| - | 4664456_MatoSpectoru_meow_skulls_fullcolor_ff1sw_logo.png | 1888755 | 2025-07-03 07:34:14 |
| - | 4664457_MatoSpectoru_meow_skulls_fullcolor_ff2sw_logo.json | 12880 | 2025-07-03 07:34:14 |
| - | 4664457_MatoSpectoru_meow_skulls_fullcolor_ff2sw_logo.png | 1904233 | 2025-07-03 07:34:14 |
| - | 4725567_MatoSpectoru_big_slushi_chikn_nuggit_fullcolor_ff1t_logo.json | 13707 | 2025-07-02 20:36:52 |
| - | 4725567_MatoSpectoru_big_slushi_chikn_nuggit_fullcolor_ff1t_logo.png | 1290505 | 2025-07-02 20:36:52 |
| - | 4725569_MatoSpectoru_big_slushi_chikn_nuggit_fullcolor_ff1_logo.json | 13707 | 2025-07-02 20:36:53 |
| - | 4725569_MatoSpectoru_big_slushi_chikn_nuggit_fullcolor_ff1_logo.png | 1269127 | 2025-07-02 20:36:53 |
| - | 4725570_MatoSpectoru_big_slushi_chikn_nuggit_fullcolor_ff1b_logo.json | 13707 | 2025-07-02 20:36:53 |
| - | 4725570_MatoSpectoru_big_slushi_chikn_nuggit_fullcolor_ff1b_logo.png | 1267526 | 2025-07-02 20:36:53 |
| - | 4725577_MatoSpectoru_neco-arc_xtra_thicc_fullcolor_ff1t_logo.json | 15682 | 2025-07-02 20:36:47 |
| - | 4725577_MatoSpectoru_neco-arc_xtra_thicc_fullcolor_ff1t_logo.png | 1261074 | 2025-07-02 20:36:47 |
| - | 4725578_MatoSpectoru_neco-arc_xtra_thicc_fullcolor_ff1b_shake_logo.json | 15682 | 2025-07-02 20:36:48 |
| - | 4725578_MatoSpectoru_neco-arc_xtra_thicc_fullcolor_ff1b_shake_logo.png | 1350348 | 2025-07-02 20:36:48 |
| - | 4725579_MatoSpectoru_neco-arc_xtra_thicc_fullcolor_ff2b_shake_logo.json | 15682 | 2025-07-02 20:36:48 |
| - | 4725579_MatoSpectoru_neco-arc_xtra_thicc_fullcolor_ff2b_shake_logo.png | 1364068 | 2025-07-02 20:36:48 |
| - | 4725581_MatoSpectoru_neco-arc_xtra_thicc_fullcolor_ff2bsw_logo.json | 15682 | 2025-07-02 20:36:48 |
| - | 4725581_MatoSpectoru_neco-arc_xtra_thicc_fullcolor_ff2bsw_logo.png | 1327428 | 2025-07-02 20:36:48 |
| - | 4725591_MatoSpectoru_lopunny_fullcolor_ff1_logo_ib.json | 13440 | 2025-07-02 20:36:41 |
| - | 4725591_MatoSpectoru_lopunny_fullcolor_ff1_logo_ib.png | 2140588 | 2025-07-02 20:36:41 |
| - | 4725592_MatoSpectoru_lopunny_fullcolor_ff1swfx_logo_ib.json | 13440 | 2025-07-02 20:36:41 |
| - | 4725592_MatoSpectoru_lopunny_fullcolor_ff1swfx_logo_ib.png | 2149625 | 2025-07-02 20:36:41 |
| - | 4725594_MatoSpectoru_lopunny_fullcolor_ff1swcm_logo_ib.json | 13440 | 2025-07-02 20:36:42 |
| - | 4725594_MatoSpectoru_lopunny_fullcolor_ff1swcm_logo_ib.png | 2151876 | 2025-07-02 20:36:42 |
| - | 4725597_MatoSpectoru_big_coco_bandicoot_fullcolor_ff1_logo.json | 13952 | 2025-07-02 20:36:37 |
| - | 4725597_MatoSpectoru_big_coco_bandicoot_fullcolor_ff1_logo.png | 2208063 | 2025-07-02 20:36:37 |
| - | 4725599_MatoSpectoru_big_coco_bandicoot_fullcolor_ff2_logo.json | 13952 | 2025-07-02 20:36:37 |
| - | 4725599_MatoSpectoru_big_coco_bandicoot_fullcolor_ff2_logo.png | 1904995 | 2025-07-02 20:36:37 |
| - | 4725602_MatoSpectoru_big_coco_bandicoot_fullcolor_ff3bsw_logo.json | 13952 | 2025-07-02 20:36:37 |
| - | 4725602_MatoSpectoru_big_coco_bandicoot_fullcolor_ff3bsw_logo.png | 1915342 | 2025-07-02 20:36:37 |
| - | 4733323_MatoSpectoru_big_ts_fullcolor_ff1_logo.json | 11592 | 2025-07-02 19:08:26 |
| - | 4733323_MatoSpectoru_big_ts_fullcolor_ff1_logo.png | 921994 | 2025-07-02 19:08:26 |
| - | 4733324_MatoSpectoru_big_ts_fullcolor_ff1b_logo.json | 11592 | 2025-07-02 19:08:27 |
| - | 4733324_MatoSpectoru_big_ts_fullcolor_ff1b_logo.png | 946740 | 2025-07-02 19:08:27 |
| - | 4839398_MatoSpectoru_ariem_snc_fullcolor_ff1_logo.json | 15112 | 2025-07-01 23:14:50 |
| - | 4839398_MatoSpectoru_ariem_snc_fullcolor_ff1_logo.png | 1572541 | 2025-07-01 23:14:50 |
| - | 4839399_MatoSpectoru_ariem_snc_fullcolor_ff2_logo.json | 15112 | 2025-07-01 23:14:50 |
| - | 4839399_MatoSpectoru_ariem_snc_fullcolor_ff2_logo.png | 1594855 | 2025-07-01 23:14:50 |
| - | 4839402_MatoSpectoru_ariem_snc_fullcolor_ff3_logo.json | 15112 | 2025-07-01 23:14:53 |
| - | 4839402_MatoSpectoru_ariem_snc_fullcolor_ff3_logo.png | 1540632 | 2025-07-01 23:14:53 |
| - | 4839403_MatoSpectoru_ariem_snc_fullcolor_ff3sw_logo.json | 15112 | 2025-07-01 23:14:54 |
| - | 4839403_MatoSpectoru_ariem_snc_fullcolor_ff3sw_logo.png | 1578382 | 2025-07-01 23:14:54 |
| - | 4839406_MatoSpectoru_lei-yin_2023_ff1_logo.json | 12863 | 2025-07-01 23:14:42 |
| - | 4839406_MatoSpectoru_lei-yin_2023_ff1_logo.png | 1772142 | 2025-07-01 23:14:42 |
| - | 4839408_MatoSpectoru_lei-yin_2023_ff1_logo_t.json | 12863 | 2025-07-01 23:14:42 |
| - | 4839408_MatoSpectoru_lei-yin_2023_ff1_logo_t.png | 1749740 | 2025-07-01 23:14:42 |
| - | 4839410_MatoSpectoru_lei-yin_2023_ff1bsw_logo.json | 12863 | 2025-07-01 23:14:42 |
| - | 4839410_MatoSpectoru_lei-yin_2023_ff1bsw_logo.png | 1787489 | 2025-07-01 23:14:42 |
| - | 4839412_MatoSpectoru_blz_th_ct_fullcolor_ff1_logo.json | 14256 | 2025-07-01 23:14:38 |
| - | 4839412_MatoSpectoru_blz_th_ct_fullcolor_ff1_logo.png | 1880871 | 2025-07-01 23:14:38 |
| - | 4839413_MatoSpectoru_blz_th_ct_fullcolor_ff2_logo.json | 14256 | 2025-07-01 23:14:38 |
| - | 4839413_MatoSpectoru_blz_th_ct_fullcolor_ff2_logo.png | 2006790 | 2025-07-01 23:14:38 |
| - | 4839414_MatoSpectoru_blz_th_ct_fullcolor_ff2sw_logo.json | 14256 | 2025-07-01 23:14:38 |
| - | 4839414_MatoSpectoru_blz_th_ct_fullcolor_ff2sw_logo.png | 2032718 | 2025-07-01 23:14:38 |
| - | 4839417_MatoSpectoru_toriel_team_fullcolor_ff1_bikinigllogo.json | 14704 | 2025-07-01 23:14:34 |
| - | 4839417_MatoSpectoru_toriel_team_fullcolor_ff1_bikinigllogo.png | 1735316 | 2025-07-01 23:14:34 |
| - | 4839418_MatoSpectoru_toriel_team_fullcolor_ff1logo.jpg | 1195133 | 2025-07-01 23:14:34 |
| - | 4839418_MatoSpectoru_toriel_team_fullcolor_ff1logo.json | 14704 | 2025-07-01 23:14:34 |
| - | 4839420_MatoSpectoru_toriel_team_fullcolor_ff1bsw_logo.json | 14704 | 2025-07-01 23:14:35 |
| - | 4839420_MatoSpectoru_toriel_team_fullcolor_ff1bsw_logo.png | 1714402 | 2025-07-01 23:14:35 |
| - | 4839422_MatoSpectoru_zhen_kgp_fullcolor_ff1_logo.json | 14035 | 2025-07-01 23:14:31 |
| - | 4839422_MatoSpectoru_zhen_kgp_fullcolor_ff1_logo.png | 2375675 | 2025-07-01 23:14:31 |
| - | 4839423_MatoSpectoru_zhen_kgp_fullcolor_ff1t_logo.json | 14035 | 2025-07-01 23:14:32 |
| - | 4839423_MatoSpectoru_zhen_kgp_fullcolor_ff1t_logo.png | 2282513 | 2025-07-01 23:14:32 |
| - | 4839426_MatoSpectoru_zhen_kgp_fullcolor_ff1sw_logo.json | 14035 | 2025-07-01 23:14:32 |
| - | 4839426_MatoSpectoru_zhen_kgp_fullcolor_ff1sw_logo.png | 2403018 | 2025-07-01 23:14:32 |
| - | 4839434_MatoSpectoru_tngl_th_lemr_comm_fullcolor_a_suit_ff1_logo.json | 14871 | 2025-07-01 23:14:24 |
| - | 4839434_MatoSpectoru_tngl_th_lemr_comm_fullcolor_a_suit_ff1_logo.png | 962192 | 2025-07-01 23:14:24 |
| - | 4839437_MatoSpectoru_tngl_th_lemr_comm_fullcolor_a_nude_ff1_logo.json | 14871 | 2025-07-01 23:14:24 |
| - | 4839437_MatoSpectoru_tngl_th_lemr_comm_fullcolor_a_nude_ff1_logo.png | 949637 | 2025-07-01 23:14:24 |
| - | 4839439_MatoSpectoru_tngl_th_lemr_comm_fullcolor_a_nude_ff1sw_logo.json | 14871 | 2025-07-01 23:14:25 |
| - | 4839439_MatoSpectoru_tngl_th_lemr_comm_fullcolor_a_nude_ff1sw_logo.png | 982716 | 2025-07-01 23:14:25 |
| - | 4839443_MatoSpectoru_tngl_th_lemr_comm_fullcolor_b_ff2mt_logo.json | 15205 | 2025-07-01 23:14:17 |
| - | 4839443_MatoSpectoru_tngl_th_lemr_comm_fullcolor_b_ff2mt_logo.png | 1191624 | 2025-07-01 23:14:17 |
| - | 4839444_MatoSpectoru_tngl_th_lemr_comm_fullcolor_b_ff1mt_t_logo.json | 15205 | 2025-07-01 23:14:17 |
| - | 4839444_MatoSpectoru_tngl_th_lemr_comm_fullcolor_b_ff1mt_t_logo.png | 1215967 | 2025-07-01 23:14:17 |
| - | 4839447_MatoSpectoru_tngl_th_lemr_comm_fullcolor_b_ff2mtsw_logo.json | 15205 | 2025-07-01 23:14:18 |
| - | 4839447_MatoSpectoru_tngl_th_lemr_comm_fullcolor_b_ff2mtsw_logo.png | 1214667 | 2025-07-01 23:14:18 |
| - | 4839451_MatoSpectoru_fnnk_fullcolor_ff2_logo.json | 13526 | 2025-07-01 23:14:09 |
| - | 4839451_MatoSpectoru_fnnk_fullcolor_ff2_logo.png | 1749923 | 2025-07-01 23:14:09 |
| - | 4839455_MatoSpectoru_fnnk_fullcolor_ff3_logo.json | 13526 | 2025-07-01 23:14:09 |
| - | 4839455_MatoSpectoru_fnnk_fullcolor_ff3_logo.png | 1843130 | 2025-07-01 23:14:09 |
| - | 4839456_MatoSpectoru_fnnk_fullcolor_ff4_logo.json | 13526 | 2025-07-01 23:14:09 |
| - | 4839456_MatoSpectoru_fnnk_fullcolor_ff4_logo.png | 1869520 | 2025-07-01 23:14:09 |
| - | 4839458_MatoSpectoru_001_isbll_fullcolor_suit_ff1t_logo.json | 14163 | 2025-07-01 23:14:03 |
| - | 4839458_MatoSpectoru_001_isbll_fullcolor_suit_ff1t_logo.png | 1866846 | 2025-07-01 23:14:03 |
| - | 4839461_MatoSpectoru_002_isbll_fullcolor_nude_ff1_logo.json | 14163 | 2025-07-01 23:14:03 |
| - | 4839461_MatoSpectoru_002_isbll_fullcolor_nude_ff1_logo.png | 1843442 | 2025-07-01 23:14:03 |
| - | 4839463_MatoSpectoru_003_isbll_fullcolor_nude_ff2swt_logo.json | 14163 | 2025-07-01 23:14:03 |
| - | 4839463_MatoSpectoru_003_isbll_fullcolor_nude_ff2swt_logo.png | 1849412 | 2025-07-01 23:14:03 |
| - | 5061623_MatoSpectoru_001_zrark_x_gthtll_fullcolor_ff1t_logo.json | 14100 | 2025-06-30 05:31:19 |
| - | 5061623_MatoSpectoru_001_zrark_x_gthtll_fullcolor_ff1t_logo.png | 4973577 | 2025-06-30 05:31:19 |
| - | 5061624_MatoSpectoru_002_zrark_x_gthtll_fullcolor_ff1_logo.json | 14100 | 2025-06-30 05:31:20 |
| - | 5061624_MatoSpectoru_002_zrark_x_gthtll_fullcolor_ff1_logo.png | 4997357 | 2025-06-30 05:31:20 |
| - | 5061625_MatoSpectoru_003_zrark_x_gthtll_fullcolor_ff1sw_logo.json | 14100 | 2025-06-30 05:31:20 |
| - | 5061625_MatoSpectoru_003_zrark_x_gthtll_fullcolor_ff1sw_logo.png | 5044625 | 2025-06-30 05:31:20 |
| - | 5061626_MatoSpectoru_001_grdvr_x_phrms_fullcolor_ff1.json | 11111 | 2025-06-30 05:31:18 |
| - | 5061626_MatoSpectoru_001_grdvr_x_phrms_fullcolor_ff1.png | 1416261 | 2025-06-30 05:31:18 |
| - | 5061627_MatoSpectoru_002_grdvr_x_phrms_fullcolor_ff2.json | 11111 | 2025-06-30 05:31:18 |
| - | 5061627_MatoSpectoru_002_grdvr_x_phrms_fullcolor_ff2.png | 1381826 | 2025-06-30 05:31:18 |
| - | 5061630_MatoSpectoru_toriel_bath_fullcolor_ff1_crop.json | 8578 | 2025-06-30 05:31:15 |
| - | 5061630_MatoSpectoru_toriel_bath_fullcolor_ff1_crop.png | 4417645 | 2025-06-30 05:31:15 |
| - | 5061652_MatoSpectoru_dzz_plwrld_fullcolor_suit_ff1a_logo.json | 12143 | 2025-06-30 05:31:03 |
| - | 5061652_MatoSpectoru_dzz_plwrld_fullcolor_suit_ff1a_logo.png | 1662469 | 2025-06-30 05:31:03 |
| - | 5061654_MatoSpectoru_dzz_plwrld_fullcolor_suit_ff1ac_logo.json | 12143 | 2025-06-30 05:31:03 |
| - | 5061654_MatoSpectoru_dzz_plwrld_fullcolor_suit_ff1ac_logo.png | 1667093 | 2025-06-30 05:31:03 |
| - | 5061683_MatoSpectoru_001_prl_prevence3_fullcolor_suit_ff1_b.json | 21012 | 2025-06-30 05:30:45 |
| - | 5061683_MatoSpectoru_001_prl_prevence3_fullcolor_suit_ff1_b.png | 1970480 | 2025-06-30 05:30:45 |
| - | 5061684_MatoSpectoru_001_prl_prevence3_fullcolor_suit_ff1_logo.json | 21012 | 2025-06-30 05:30:45 |
| - | 5061684_MatoSpectoru_001_prl_prevence3_fullcolor_suit_ff1_logo.png | 1970541 | 2025-06-30 05:30:45 |
| - | 5061685_MatoSpectoru_002_prl_prevence3_fullcolor_suit_ff1sw_b.json | 21012 | 2025-06-30 05:30:45 |
| - | 5061685_MatoSpectoru_002_prl_prevence3_fullcolor_suit_ff1sw_b.png | 1969142 | 2025-06-30 05:30:45 |
| - | 5061686_MatoSpectoru_002_prl_prevence3_fullcolor_suit_ff1sw_logo.json | 21012 | 2025-06-30 05:30:46 |
| - | 5061686_MatoSpectoru_002_prl_prevence3_fullcolor_suit_ff1sw_logo.png | 1969204 | 2025-06-30 05:30:46 |
| - | 5061688_MatoSpectoru_003_prl_prevence3_fullcolor_suit_ff1bsw_logo.json | 21012 | 2025-06-30 05:30:46 |
| - | 5061688_MatoSpectoru_003_prl_prevence3_fullcolor_suit_ff1bsw_logo.png | 1921678 | 2025-06-30 05:30:46 |
| - | 5061689_MatoSpectoru_003_prl_prevence3_fullcolor_suit_ff1bsw_logo_b.json | 21012 | 2025-06-30 05:30:47 |
| - | 5061689_MatoSpectoru_003_prl_prevence3_fullcolor_suit_ff1bsw_logo_b.png | 1921591 | 2025-06-30 05:30:47 |
| - | 5061727_MatoSpectoru_lei_yin_oc_2024_february_character_sheet.json | 8765 | 2025-06-30 05:30:26 |
| - | 5061727_MatoSpectoru_lei_yin_oc_2024_february_character_sheet.png | 1305304 | 2025-06-30 05:30:26 |
| - | 5061762_MatoSpectoru_001_vnll_x_cw_fullcolor_ff1t_logo.json | 14499 | 2025-06-30 05:30:00 |
| - | 5061762_MatoSpectoru_001_vnll_x_cw_fullcolor_ff1t_logo.png | 1567581 | 2025-06-30 05:30:00 |
| - | 5061764_MatoSpectoru_002_vnll_x_cw_fullcolor_ff1_logo.json | 14499 | 2025-06-30 05:30:01 |
| - | 5061764_MatoSpectoru_002_vnll_x_cw_fullcolor_ff1_logo.png | 1566547 | 2025-06-30 05:30:01 |
| - | 5061766_MatoSpectoru_003_vnll_x_cw_fullcolor_ff1v_logo.json | 14499 | 2025-06-30 05:30:03 |
| - | 5061766_MatoSpectoru_003_vnll_x_cw_fullcolor_ff1v_logo.png | 1637620 | 2025-06-30 05:30:03 |
| - | 5061769_MatoSpectoru_slr_flre_oc_comm_flatcolor_ff1.json | 13145 | 2025-06-30 05:29:55 |
| - | 5061769_MatoSpectoru_slr_flre_oc_comm_flatcolor_ff1.png | 248521 | 2025-06-30 05:29:55 |
| - | 5061770_MatoSpectoru_slr_flre_oc_comm_flatcolor_ff1b.json | 13145 | 2025-06-30 05:29:56 |
| - | 5061770_MatoSpectoru_slr_flre_oc_comm_flatcolor_ff1b.png | 269323 | 2025-06-30 05:29:56 |
| - | 5061771_MatoSpectoru_slr_flre_oc_comm_flatcolor_ff1t.json | 13145 | 2025-06-30 05:29:57 |
| - | 5061771_MatoSpectoru_slr_flre_oc_comm_flatcolor_ff1t.png | 267101 | 2025-06-30 05:29:57 |
| - | 5061783_MatoSpectoru_sadie_polecat_oc_comm_fullcolor_nude_f1.json | 10995 | 2025-06-30 05:29:19 |
| - | 5061783_MatoSpectoru_sadie_polecat_oc_comm_fullcolor_nude_f1.png | 347821 | 2025-06-30 05:29:19 |
| - | 5061784_MatoSpectoru_sadie_polecat_oc_comm_fullcolor_suit_f1.json | 10995 | 2025-06-30 05:29:19 |
| - | 5061784_MatoSpectoru_sadie_polecat_oc_comm_fullcolor_suit_f1.png | 407810 | 2025-06-30 05:29:19 |
| - | 5061786_MatoSpectoru_plwrld_bellanoir_fullcolor_ff1sw_logo.json | 11154 | 2025-06-30 05:29:18 |
| - | 5061786_MatoSpectoru_plwrld_bellanoir_fullcolor_ff1sw_logo.png | 1870725 | 2025-06-30 05:29:18 |
| - | 5061787_MatoSpectoru_plwrld_bellanoir_fullcolor_ff1t_logo.json | 11154 | 2025-06-30 05:29:18 |
| - | 5061787_MatoSpectoru_plwrld_bellanoir_fullcolor_ff1t_logo.png | 1891153 | 2025-06-30 05:29:18 |
| - | 5061801_MatoSpectoru_flcia_drkslkrs_fanart_poll_march_2024_fullcolor_original_suit_ff1t_logo.json | 15659 | 2025-06-30 05:28:58 |
| - | 5061801_MatoSpectoru_flcia_drkslkrs_fanart_poll_march_2024_fullcolor_original_suit_ff1t_logo.png | 2135778 | 2025-06-30 05:28:58 |
| - | 5061802_MatoSpectoru_flcia_drkslkrs_fanart_poll_march_2024_fullcolor_original_suit_ff2sw_logo.json | 15659 | 2025-06-30 05:28:59 |
| - | 5061802_MatoSpectoru_flcia_drkslkrs_fanart_poll_march_2024_fullcolor_original_suit_ff2sw_logo.png | 2118133 | 2025-06-30 05:28:59 |
| - | 5061804_MatoSpectoru_flcia_drkslkrs_fanart_poll_march_2024_fullcolor_original_suit_ff3swc_logo.json | 15659 | 2025-06-30 05:28:59 |
| - | 5061804_MatoSpectoru_flcia_drkslkrs_fanart_poll_march_2024_fullcolor_original_suit_ff3swc_logo.png | 2123310 | 2025-06-30 05:28:59 |
| - | 5061829_MatoSpectoru_001_lpnn_easter_2024_fullcolor_ff1nt_logo.json | 14907 | 2025-06-30 05:28:42 |
| - | 5061829_MatoSpectoru_001_lpnn_easter_2024_fullcolor_ff1nt_logo.png | 2244434 | 2025-06-30 05:28:42 |
| - | 5061830_MatoSpectoru_002_lpnn_easter_2024_fullcolor_ff1nsw_logo.json | 14907 | 2025-06-30 05:28:42 |
| - | 5061830_MatoSpectoru_002_lpnn_easter_2024_fullcolor_ff1nsw_logo.png | 2197244 | 2025-06-30 05:28:42 |
| - | 5061831_MatoSpectoru_003_lpnn_easter_2024_fullcolor_ff1nswc_logo.json | 14907 | 2025-06-30 05:28:44 |
| - | 5061831_MatoSpectoru_003_lpnn_easter_2024_fullcolor_ff1nswc_logo.png | 2200821 | 2025-06-30 05:28:44 |
| - | 5061834_MatoSpectoru_001_hariet_2024_fullcolor_suit_ff1t_logo.json | 14828 | 2025-06-30 05:28:38 |
| - | 5061834_MatoSpectoru_001_hariet_2024_fullcolor_suit_ff1t_logo.png | 2523197 | 2025-06-30 05:28:38 |
| - | 5061835_MatoSpectoru_002_hariet_2024_fullcolor_nude_ff2_logo.json | 14828 | 2025-06-30 05:28:40 |
| - | 5061835_MatoSpectoru_002_hariet_2024_fullcolor_nude_ff2_logo.png | 2371756 | 2025-06-30 05:28:40 |
| - | 5061836_MatoSpectoru_003_hariet_2024_fullcolor_nude_ff2c_logo.json | 14828 | 2025-06-30 05:28:41 |
| - | 5061836_MatoSpectoru_003_hariet_2024_fullcolor_nude_ff2c_logo.png | 2377013 | 2025-06-30 05:28:41 |
| - | 5061844_MatoSpectoru_001susie_oc_pkm_comm_fullcolor_ff1_logo.json | 17169 | 2025-06-30 05:28:29 |
| - | 5061844_MatoSpectoru_001susie_oc_pkm_comm_fullcolor_ff1_logo.png | 2051218 | 2025-06-30 05:28:29 |
| - | 5061847_MatoSpectoru_002susie_oc_pkm_comm_fullcolor_ff2_logo.json | 17169 | 2025-06-30 05:28:29 |
| - | 5061847_MatoSpectoru_002susie_oc_pkm_comm_fullcolor_ff2_logo.png | 2037708 | 2025-06-30 05:28:29 |
| - | 5061850_MatoSpectoru_003susie_oc_pkm_comm_fullcolor_ff1b_logo.json | 17169 | 2025-06-30 05:28:28 |
| - | 5061850_MatoSpectoru_003susie_oc_pkm_comm_fullcolor_ff1b_logo.png | 2050865 | 2025-06-30 05:28:28 |
| - | 5061851_MatoSpectoru_004susie_oc_pkm_comm_fullcolor_ff2b_logo.json | 17169 | 2025-06-30 05:28:29 |
| - | 5061851_MatoSpectoru_004susie_oc_pkm_comm_fullcolor_ff2b_logo.png | 2040447 | 2025-06-30 05:28:29 |
| - | 5061861_MatoSpectoru_grnt_oc_pkmn_comm_fullcolor_ff1a_logo.json | 13666 | 2025-06-30 05:28:20 |
| - | 5061861_MatoSpectoru_grnt_oc_pkmn_comm_fullcolor_ff1a_logo.png | 2016000 | 2025-06-30 05:28:20 |
| - | 5061862_MatoSpectoru_grnt_oc_pkmn_comm_fullcolor_ff1c_logo.json | 13666 | 2025-06-30 05:28:21 |
| - | 5061862_MatoSpectoru_grnt_oc_pkmn_comm_fullcolor_ff1c_logo.png | 1999968 | 2025-06-30 05:28:21 |
| - | 5061864_MatoSpectoru_grnt_oc_pkmn_comm_fullcolor_ff1e_logo.json | 13666 | 2025-06-30 05:28:21 |
| - | 5061864_MatoSpectoru_grnt_oc_pkmn_comm_fullcolor_ff1e_logo.png | 1971364 | 2025-06-30 05:28:21 |
| - | 5061867_MatoSpectoru_rge_x_knkles_vulkyasha_fullcolor_2.0_ff1_logo.json | 16767 | 2025-06-30 05:28:18 |
| - | 5061867_MatoSpectoru_rge_x_knkles_vulkyasha_fullcolor_2.0_ff1_logo.png | 2065389 | 2025-06-30 05:28:18 |
| - | 5061868_MatoSpectoru_rge_x_knkles_vulkyasha_fullcolor_2.0_ff1c_logo.json | 16767 | 2025-06-30 05:28:18 |
| - | 5061868_MatoSpectoru_rge_x_knkles_vulkyasha_fullcolor_2.0_ff1c_logo.png | 2079747 | 2025-06-30 05:28:18 |
| - | 5061869_MatoSpectoru_rge_x_knkles_vulkyasha_fullcolor_2.0_ff1ct_logo.json | 16767 | 2025-06-30 05:28:18 |
| - | 5061869_MatoSpectoru_rge_x_knkles_vulkyasha_fullcolor_2.0_ff1ct_logo.png | 2090964 | 2025-06-30 05:28:18 |
| - | 5061876_MatoSpectoru_001_lovander_fanart_poll_april_2024_fullcolor_ff1t_logo.json | 15810 | 2025-06-30 05:28:15 |
| - | 5061876_MatoSpectoru_001_lovander_fanart_poll_april_2024_fullcolor_ff1t_logo.png | 2149039 | 2025-06-30 05:28:15 |
| - | 5061877_MatoSpectoru_002_lovander_fanart_poll_april_2024_fullcolor_ff1c_logo.json | 15810 | 2025-06-30 05:28:16 |
| - | 5061877_MatoSpectoru_002_lovander_fanart_poll_april_2024_fullcolor_ff1c_logo.png | 2135224 | 2025-06-30 05:28:16 |
| - | 5061878_MatoSpectoru_003_lovander_fanart_poll_april_2024_fullcolor_ff2ct_logo.json | 15810 | 2025-06-30 05:28:16 |
| - | 5061878_MatoSpectoru_003_lovander_fanart_poll_april_2024_fullcolor_ff2ct_logo.png | 2176868 | 2025-06-30 05:28:16 |
| - | 5061936_MatoSpectoru_001_jade_oc_comm_fullcolor_suit_ff1t_logo.json | 14098 | 2025-06-30 05:27:22 |
| - | 5061936_MatoSpectoru_001_jade_oc_comm_fullcolor_suit_ff1t_logo.png | 2140770 | 2025-06-30 05:27:22 |
| - | 5061937_MatoSpectoru_002_jade_oc_comm_fullcolor_nude_ff1t_logo.json | 14098 | 2025-06-30 05:27:22 |
| - | 5061937_MatoSpectoru_002_jade_oc_comm_fullcolor_nude_ff1t_logo.png | 2122380 | 2025-06-30 05:27:22 |
| - | 5061939_MatoSpectoru_003_jade_oc_comm_fullcolor_nude_ff2ct_logo.json | 14098 | 2025-06-30 05:27:22 |
| - | 5061939_MatoSpectoru_003_jade_oc_comm_fullcolor_nude_ff2ct_logo.png | 2123401 | 2025-06-30 05:27:22 |
| - | 5061944_MatoSpectoru_001_krystal_sfa_fullcolor_suit_ff1_logo.json | 15028 | 2025-06-30 05:27:19 |
| - | 5061944_MatoSpectoru_001_krystal_sfa_fullcolor_suit_ff1_logo.png | 1888258 | 2025-06-30 05:27:19 |
| - | 5061945_MatoSpectoru_002_krystal_sfa_fullcolor_suit_ff2bswt_logo.json | 15028 | 2025-06-30 05:27:19 |
| - | 5061945_MatoSpectoru_002_krystal_sfa_fullcolor_suit_ff2bswt_logo.png | 1902213 | 2025-06-30 05:27:19 |
| - | 5061946_MatoSpectoru_003_krystal_sfa_fullcolor_nude_ff2msw_logo.json | 15028 | 2025-06-30 05:27:20 |
| - | 5061946_MatoSpectoru_003_krystal_sfa_fullcolor_nude_ff2msw_logo.png | 1846426 | 2025-06-30 05:27:20 |
| - | 5061952_MatoSpectoru_lavendula_oc_comm_fullcolor_suit_ff1.json | 14471 | 2025-06-30 05:27:15 |
| - | 5061952_MatoSpectoru_lavendula_oc_comm_fullcolor_suit_ff1.png | 459604 | 2025-06-30 05:27:15 |
| - | 5061954_MatoSpectoru_lavendula_oc_comm_fullcolor_nude_ff1.json | 14471 | 2025-06-30 05:27:15 |
| - | 5061954_MatoSpectoru_lavendula_oc_comm_fullcolor_nude_ff1.png | 415163 | 2025-06-30 05:27:15 |
| - | 5061955_MatoSpectoru_lavendula_oc_comm_fullcolor_nude_ff1pr.json | 14471 | 2025-06-30 05:27:16 |
| - | 5061955_MatoSpectoru_lavendula_oc_comm_fullcolor_nude_ff1pr.png | 432958 | 2025-06-30 05:27:16 |
| - | 5064117_MatoSpectoru_003_roxanne_wolf_2024_fullcolor_nude_fff1fsw_logo.json | 9593 | 2025-06-30 05:06:37 |
| - | 5064117_MatoSpectoru_003_roxanne_wolf_2024_fullcolor_nude_fff1fsw_logo.png | 2122703 | 2025-06-30 05:06:37 |
| - | 5067519_MatoSpectoru_garina_oc_comm_fullcolor_ff1.json | 10820 | 2025-06-30 04:27:20 |
| - | 5067519_MatoSpectoru_garina_oc_comm_fullcolor_ff1.png | 1762665 | 2025-06-30 04:27:20 |
| - | 5067520_MatoSpectoru_garina_oc_comm_fullcolor_ff2.json | 10820 | 2025-06-30 04:27:20 |
| - | 5067520_MatoSpectoru_garina_oc_comm_fullcolor_ff2.png | 1781925 | 2025-06-30 04:27:20 |
| - | 5069237_MatoSpectoru_001_blaziken_2024_fullcolor_bikini_ff1t_logo.json | 14378 | 2025-06-30 04:06:27 |
| - | 5069237_MatoSpectoru_001_blaziken_2024_fullcolor_bikini_ff1t_logo.png | 2185075 | 2025-06-30 04:06:27 |
| - | 5069238_MatoSpectoru_002_blaziken_2024_fullcolor_nude_ff1_logo.json | 14378 | 2025-06-30 04:06:28 |
| - | 5069238_MatoSpectoru_002_blaziken_2024_fullcolor_nude_ff1_logo.png | 2136206 | 2025-06-30 04:06:28 |
| - | 5069240_MatoSpectoru_003_blaziken_2024_fullcolor_nude_ff1sw_logo.json | 14378 | 2025-06-30 04:06:29 |
| - | 5069240_MatoSpectoru_003_blaziken_2024_fullcolor_nude_ff1sw_logo.png | 2149008 | 2025-06-30 04:06:29 |
| - | 5101497_MatoSpectoru_001_midna_may_2024_fanartpoll_fullcolor_ff1_logo.json | 15836 | 2025-06-29 22:09:08 |
| - | 5101497_MatoSpectoru_001_midna_may_2024_fanartpoll_fullcolor_ff1_logo.png | 2142162 | 2025-06-29 22:09:08 |
| - | 5101498_MatoSpectoru_002_midna_may_2024_fanartpoll_fullcolor_ff1t_logo.json | 15836 | 2025-06-29 22:09:08 |
| - | 5101498_MatoSpectoru_002_midna_may_2024_fanartpoll_fullcolor_ff1t_logo.png | 2178703 | 2025-06-29 22:09:08 |
| - | 5101500_MatoSpectoru_003_midna_may_2024_fanartpoll_fullcolor_ff1sw_logo.json | 15836 | 2025-06-29 22:09:09 |
| - | 5101500_MatoSpectoru_003_midna_may_2024_fanartpoll_fullcolor_ff1sw_logo.png | 2163932 | 2025-06-29 22:09:09 |
| - | 5101503_MatoSpectoru_001_raven_team_leader_june_2024_fullcolor_bikini_ff1t_logo.json | 14897 | 2025-06-29 22:09:05 |
| - | 5101503_MatoSpectoru_001_raven_team_leader_june_2024_fullcolor_bikini_ff1t_logo.png | 1747239 | 2025-06-29 22:09:05 |
| - | 5101506_MatoSpectoru_002_raven_team_leader_june_2024_fullcolor_bikini_ff1bsw_logo.json | 14897 | 2025-06-29 22:09:05 |
| - | 5101506_MatoSpectoru_002_raven_team_leader_june_2024_fullcolor_bikini_ff1bsw_logo.png | 1735314 | 2025-06-29 22:09:05 |
| - | 5101507_MatoSpectoru_003_raven_team_leader_june_2024_fullcolor_nude_ff1sw_logo.json | 14897 | 2025-06-29 22:09:05 |
| - | 5101507_MatoSpectoru_003_raven_team_leader_june_2024_fullcolor_nude_ff1sw_logo.png | 1700706 | 2025-06-29 22:09:05 |
| - | 5101511_MatoSpectoru_001_conductor_s_wife_june_2024_fanartpoll_fullcolor_ff1_at_logo.json | 16949 | 2025-06-29 22:08:57 |
| - | 5101511_MatoSpectoru_001_conductor_s_wife_june_2024_fanartpoll_fullcolor_ff1_at_logo.png | 1715417 | 2025-06-29 22:08:57 |
| - | 5101512_MatoSpectoru_002_conductor_s_wife_june_2024_fanartpoll_fullcolor_ff1_swt_logo.json | 16949 | 2025-06-29 22:08:57 |
| - | 5101512_MatoSpectoru_002_conductor_s_wife_june_2024_fanartpoll_fullcolor_ff1_swt_logo.png | 1698707 | 2025-06-29 22:08:57 |
| - | 5101514_MatoSpectoru_003_conductor_s_wife_june_2024_fanartpoll_fullcolor_ff1_cswcm_logo.json | 16949 | 2025-06-29 22:08:57 |
| - | 5101514_MatoSpectoru_003_conductor_s_wife_june_2024_fanartpoll_fullcolor_ff1_cswcm_logo.png | 1684499 | 2025-06-29 22:08:57 |
| - | 5101528_MatoSpectoru_001_hatterene_brimuon_june_2024_fullcolor_bikini_ff1t_logo.json | 15258 | 2025-06-29 22:08:46 |
| - | 5101528_MatoSpectoru_001_hatterene_brimuon_june_2024_fullcolor_bikini_ff1t_logo.png | 2122525 | 2025-06-29 22:08:46 |
| - | 5101529_MatoSpectoru_002_hatterene_brimuon_june_2024_fullcolor_bikini_ff2bshk_logo.json | 15258 | 2025-06-29 22:08:47 |
| - | 5101529_MatoSpectoru_002_hatterene_brimuon_june_2024_fullcolor_bikini_ff2bshk_logo.png | 2111169 | 2025-06-29 22:08:47 |
| - | 5101530_MatoSpectoru_003_hatterene_brimuon_june_2024_fullcolor_nude_ff2swshk_logo.json | 15258 | 2025-06-29 22:08:47 |
| - | 5101530_MatoSpectoru_003_hatterene_brimuon_june_2024_fullcolor_nude_ff2swshk_logo.png | 2076280 | 2025-06-29 22:08:47 |
| - | 5119600_MatoSpectoru_bulbasaur_adopt_july_2024_steps_2.0.gif | 238129 | 2025-06-29 18:35:45 |
| - | 5119600_MatoSpectoru_bulbasaur_adopt_july_2024_steps_2.0.json | 12377 | 2025-06-29 18:35:45 |
| - | 517073_MatoSpectoru_1362421040.matospectoru_buffalo_bell__lr_b.json | 6365 | 2025-04-20 21:09:30 |
| - | 517073_MatoSpectoru_1362421040.matospectoru_buffalo_bell__lr_b.png | 212926 | 2025-04-20 21:09:30 |
| - | 517077_MatoSpectoru_lopunny_ps_lr.json | 6182 | 2025-04-20 21:09:34 |
| - | 517077_MatoSpectoru_lopunny_ps_lr.png | 749875 | 2025-04-20 21:09:34 |
| - | 517083_MatoSpectoru_1362788666.matospectoru_renamon_18__psclr.json | 7777 | 2025-04-20 21:09:40 |
| - | 517083_MatoSpectoru_1362788666.matospectoru_renamon_18__psclr.png | 468197 | 2025-04-20 21:09:40 |
| - | 517086_MatoSpectoru_meloetta_18__pslrb.json | 5624 | 2025-04-20 21:09:44 |
| - | 517086_MatoSpectoru_meloetta_18__pslrb.png | 358299 | 2025-04-20 21:09:44 |
| - | 517091_MatoSpectoru_1362962231.matospectoru_weavile_18__pscb2lr.json | 5399 | 2025-04-20 21:09:49 |
| - | 517091_MatoSpectoru_1362962231.matospectoru_weavile_18__pscb2lr.png | 226608 | 2025-04-20 21:09:49 |
| - | 517096_MatoSpectoru_1363116063.matospectoru_pinkie_pie_18__b_ps_lr.json | 6519 | 2025-04-20 21:09:55 |
| - | 517096_MatoSpectoru_1363116063.matospectoru_pinkie_pie_18__b_ps_lr.png | 231659 | 2025-04-20 21:09:55 |
| - | 517100_MatoSpectoru_midna_18__b_ps__edit_bnose.json | 7230 | 2025-04-20 21:10:01 |
| - | 517100_MatoSpectoru_midna_18__b_ps__edit_bnose.png | 323468 | 2025-04-20 21:10:01 |
| - | 517104_MatoSpectoru_amy_rose_18__b2_pssailr.json | 5220 | 2025-04-20 21:10:06 |
| - | 517104_MatoSpectoru_amy_rose_18__b2_pssailr.png | 282114 | 2025-04-20 21:10:06 |
| - | 517109_MatoSpectoru_rarity_18__pslrb.json | 6636 | 2025-04-20 21:10:11 |
| - | 517109_MatoSpectoru_rarity_18__pslrb.png | 263722 | 2025-04-20 21:10:11 |
| - | 517111_MatoSpectoru_twilight_human_18_colorpslrf.json | 9403 | 2025-04-20 21:10:13 |
| - | 517111_MatoSpectoru_twilight_human_18_colorpslrf.png | 209175 | 2025-04-20 21:10:13 |
| - | 517119_MatoSpectoru_twilight-human-18_-coloreditlrlentesb.json | 9474 | 2025-04-20 21:10:21 |
| - | 517119_MatoSpectoru_twilight-human-18_-coloreditlrlentesb.png | 410241 | 2025-04-20 21:10:21 |
| - | 517837_MatoSpectoru_midna-2-18_-_1_pslr.json | 12263 | 2025-04-20 21:22:02 |
| - | 517837_MatoSpectoru_midna-2-18_-_1_pslr.png | 577936 | 2025-04-20 21:22:02 |
| - | 517839_MatoSpectoru_midna-2-18_-_2_pslr.json | 12263 | 2025-04-20 21:22:02 |
| - | 517839_MatoSpectoru_midna-2-18_-_2_pslr.png | 582987 | 2025-04-20 21:22:02 |
| - | 517841_MatoSpectoru_midna-2-18_-_3_pslr.json | 12263 | 2025-04-20 21:22:02 |
| - | 517841_MatoSpectoru_midna-2-18_-_3_pslr.png | 593465 | 2025-04-20 21:22:02 |
| - | 517861_MatoSpectoru_tumblr_mjjehdop531s69dj1o1_1280.json | 6627 | 2025-04-20 21:22:09 |
| - | 517861_MatoSpectoru_tumblr_mjjehdop531s69dj1o1_1280.png | 246686 | 2025-04-20 21:22:09 |
| - | 517867_MatoSpectoru_twilight-human-18_-coloreditlr.json | 9474 | 2025-04-20 21:10:21 |
| - | 517867_MatoSpectoru_twilight-human-18_-coloreditlr.png | 315609 | 2025-04-20 21:10:21 |
| - | 517872_MatoSpectoru_twilight_human_18__sinlentes_pslrf.json | 9403 | 2025-04-20 21:10:14 |
| - | 517872_MatoSpectoru_twilight_human_18__sinlentes_pslrf.png | 204609 | 2025-04-20 21:10:14 |
| - | 5330678_MatoSpectoru_beedrill_oc_adoptable_november_2024_original_nsfw_af_steps_watermark.gif | 411062 | 2025-06-27 22:58:51 |
| - | 5330678_MatoSpectoru_beedrill_oc_adoptable_november_2024_original_nsfw_af_steps_watermark.json | 21496 | 2025-06-27 22:58:51 |
| - | 5330679_MatoSpectoru_beedrill_oc_adoptable_november_2024_original_nsfw_af_wmf.json | 21496 | 2025-06-27 22:58:52 |
| - | 5330679_MatoSpectoru_beedrill_oc_adoptable_november_2024_original_nsfw_af_wmf.png | 535305 | 2025-06-27 22:58:52 |
| - | 5330680_MatoSpectoru_beedrill_oc_adoptable_november_2024_original_sfw_af_wmf.json | 21496 | 2025-06-27 22:58:52 |
| - | 5330680_MatoSpectoru_beedrill_oc_adoptable_november_2024_original_sfw_af_wmf.png | 529853 | 2025-06-27 22:58:52 |
| - | 5330681_MatoSpectoru_beedrill_oc_adoptable_november_2024_original_sfw_bf_bikini_wmf.json | 21496 | 2025-06-27 22:58:52 |
| - | 5330681_MatoSpectoru_beedrill_oc_adoptable_november_2024_original_sfw_bf_bikini_wmf.png | 501992 | 2025-06-27 22:58:52 |
| - | 533448_MatoSpectoru_polly-18_-2-colorlr_t_c.jpg | 289205 | 2025-04-21 01:46:27 |
| - | 533448_MatoSpectoru_polly-18_-2-colorlr_t_c.json | 6915 | 2025-04-21 01:46:27 |
| - | 5504675_MatoSpectoru_001_millie_x_moxxie_hb_november_2024_comm_fullcolor_ff1_logo.json | 14946 | 2025-06-26 12:42:18 |
| - | 5504675_MatoSpectoru_001_millie_x_moxxie_hb_november_2024_comm_fullcolor_ff1_logo.png | 2971241 | 2025-06-26 12:42:18 |
| - | 5504678_MatoSpectoru_002_millie_x_moxxie_hb_november_2024_comm_fullcolor_moxxie_ff1b_logo.json | 14946 | 2025-06-26 12:42:20 |
| - | 5504678_MatoSpectoru_002_millie_x_moxxie_hb_november_2024_comm_fullcolor_moxxie_ff1b_logo.png | 1458127 | 2025-06-26 12:42:20 |
| - | 5504679_MatoSpectoru_003_millie_x_moxxie_hb_november_2024_comm_fullcolor_millie_ff1b_logo.json | 14946 | 2025-06-26 12:42:20 |
| - | 5504679_MatoSpectoru_003_millie_x_moxxie_hb_november_2024_comm_fullcolor_millie_ff1b_logo.png | 1413722 | 2025-06-26 12:42:20 |
| - | 5593460_MatoSpectoru_003_sally_atlyss_fanart_poll_p_december_2024_fullcolor_ff1swt_logo.json | 8964 | 2025-06-24 14:56:38 |
| - | 5593460_MatoSpectoru_003_sally_atlyss_fanart_poll_p_december_2024_fullcolor_ff1swt_logo.png | 2192337 | 2025-06-24 14:56:38 |
| - | 5593472_MatoSpectoru_helena_espeon_adoptable_oc_december_2024_drawing_fullcolor_bikini_ff1bf_logo.json | 17190 | 2025-06-24 14:56:32 |
| - | 5593472_MatoSpectoru_helena_espeon_adoptable_oc_december_2024_drawing_fullcolor_bikini_ff1bf_logo.png | 2548885 | 2025-06-24 14:56:32 |
| - | 5593473_MatoSpectoru_helena_espeon_adoptable_oc_december_2024_drawing_fullcolor_bikini_ff1ft_logo.json | 17190 | 2025-06-24 14:56:33 |
| - | 5593473_MatoSpectoru_helena_espeon_adoptable_oc_december_2024_drawing_fullcolor_bikini_ff1ft_logo.png | 2555267 | 2025-06-24 14:56:33 |
| - | 5593474_MatoSpectoru_helena_espeon_adoptable_oc_december_2024_drawing_fullcolor_nude_ff1f_logo.json | 17190 | 2025-06-24 14:56:33 |
| - | 5593474_MatoSpectoru_helena_espeon_adoptable_oc_december_2024_drawing_fullcolor_nude_ff1f_logo.png | 2526379 | 2025-06-24 14:56:33 |
| - | 5593475_MatoSpectoru_helena_espeon_adoptable_oc_december_2024_drawing_fullcolor_nude_ff1fsw_logo.json | 17190 | 2025-06-24 14:56:33 |
| - | 5593475_MatoSpectoru_helena_espeon_adoptable_oc_december_2024_drawing_fullcolor_nude_ff1fsw_logo.png | 2527419 | 2025-06-24 14:56:33 |
| - | 5593612_MatoSpectoru_001_amy_rose_vulkyasha_january_2025_fullcolor_classic_suit_a_ff1_logo.json | 15133 | 2025-06-24 14:55:04 |
| - | 5593612_MatoSpectoru_001_amy_rose_vulkyasha_january_2025_fullcolor_classic_suit_a_ff1_logo.png | 2483716 | 2025-06-24 14:55:04 |
| - | 5593613_MatoSpectoru_002_amy_rose_vulkyasha_january_2025_fullcolor_nude_ff3_logo.json | 15133 | 2025-06-24 14:55:09 |
| - | 5593613_MatoSpectoru_002_amy_rose_vulkyasha_january_2025_fullcolor_nude_ff3_logo.png | 2478663 | 2025-06-24 14:55:09 |
| - | 5593614_MatoSpectoru_003_amy_rose_vulkyasha_january_2025_fullcolor_nude_ff2bsw_logo.json | 15133 | 2025-06-24 14:55:09 |
| - | 5593614_MatoSpectoru_003_amy_rose_vulkyasha_january_2025_fullcolor_nude_ff2bsw_logo.png | 2482108 | 2025-06-24 14:55:09 |
| - | 5593616_MatoSpectoru_001_rouge_the_bat_february_2025_fullcolor_ff1_logo.json | 14922 | 2025-06-24 14:54:59 |
| - | 5593616_MatoSpectoru_001_rouge_the_bat_february_2025_fullcolor_ff1_logo.png | 2452766 | 2025-06-24 14:54:59 |
| - | 5593623_MatoSpectoru_002_rouge_the_bat_february_2025_fullcolor_ff2t_logo.json | 14922 | 2025-06-24 14:55:00 |
| - | 5593623_MatoSpectoru_002_rouge_the_bat_february_2025_fullcolor_ff2t_logo.png | 2466206 | 2025-06-24 14:55:00 |
| - | 5593625_MatoSpectoru_003_rouge_the_bat_february_2025_fullcolor_ff3ssw_logo.json | 14922 | 2025-06-24 14:55:00 |
| - | 5593625_MatoSpectoru_003_rouge_the_bat_february_2025_fullcolor_ff3ssw_logo.png | 2486072 | 2025-06-24 14:55:00 |
| - | 5593641_MatoSpectoru_001_millie_x_moxxie_hb_part_2_feburary_2025_comm_fullcolor_ff1_logo.json | 15689 | 2025-06-24 14:54:48 |
| - | 5593641_MatoSpectoru_001_millie_x_moxxie_hb_part_2_feburary_2025_comm_fullcolor_ff1_logo.png | 2735780 | 2025-06-24 14:54:48 |
| - | 5593642_MatoSpectoru_002_millie_x_moxxie_hb_part_2_feburary_2025_comm_fullcolor_ff2btfx_logo.json | 15689 | 2025-06-24 14:54:48 |
| - | 5593642_MatoSpectoru_002_millie_x_moxxie_hb_part_2_feburary_2025_comm_fullcolor_ff2btfx_logo.png | 2783380 | 2025-06-24 14:54:48 |
| - | 5593643_MatoSpectoru_003_millie_x_moxxie_hb_part_2_feburary_2025_comm_fullcolor_ff1c_logo.json | 15689 | 2025-06-24 14:54:49 |
| - | 5593643_MatoSpectoru_003_millie_x_moxxie_hb_part_2_feburary_2025_comm_fullcolor_ff1c_logo.png | 2747460 | 2025-06-24 14:54:49 |
| - | 5593645_MatoSpectoru_001_tsareena_fanart_poll_p_february_2025_fullcolor_nsfw_ff2_logo.json | 15061 | 2025-06-24 14:54:17 |
| - | 5593645_MatoSpectoru_001_tsareena_fanart_poll_p_february_2025_fullcolor_nsfw_ff2_logo.png | 2964618 | 2025-06-24 14:54:17 |
| - | 5593649_MatoSpectoru_002_tsareena_fanart_poll_p_february_2025_fullcolor_nsfw_ff1_logo.json | 15061 | 2025-06-24 14:54:18 |
| - | 5593649_MatoSpectoru_002_tsareena_fanart_poll_p_february_2025_fullcolor_nsfw_ff1_logo.png | 3011386 | 2025-06-24 14:54:18 |
| - | 5593651_MatoSpectoru_003_tsareena_fanart_poll_p_february_2025_fullcolor_nsfw_ff1sw_logo.json | 15061 | 2025-06-24 14:54:18 |
| - | 5593651_MatoSpectoru_003_tsareena_fanart_poll_p_february_2025_fullcolor_nsfw_ff1sw_logo.png | 3015774 | 2025-06-24 14:54:18 |
| - | 5593658_MatoSpectoru_001_vex_sxf_fanart_poll_substar_feb_2025_fullcolor_ff1_logo.json | 12732 | 2025-06-24 14:54:06 |
| - | 5593658_MatoSpectoru_001_vex_sxf_fanart_poll_substar_feb_2025_fullcolor_ff1_logo.png | 3027248 | 2025-06-24 14:54:06 |
| - | 5593659_MatoSpectoru_002_vex_sxf_fanart_poll_substar_feb_2025_fullcolor_ff1t_logo.json | 12732 | 2025-06-24 14:54:06 |
| - | 5593659_MatoSpectoru_002_vex_sxf_fanart_poll_substar_feb_2025_fullcolor_ff1t_logo.png | 3043122 | 2025-06-24 14:54:06 |
| - | 5593664_MatoSpectoru_02_kirby_march_2025_comm_fullcolor_ff1wfxb_logo.json | 12561 | 2025-06-24 14:54:04 |
| - | 5593664_MatoSpectoru_02_kirby_march_2025_comm_fullcolor_ff1wfxb_logo.png | 2809754 | 2025-06-24 14:54:04 |
| - | 5593665_MatoSpectoru_02_kirby_march_2025_comm_fullcolor_ff1wfxbnk_logo.json | 12561 | 2025-06-24 14:54:04 |
| - | 5593665_MatoSpectoru_02_kirby_march_2025_comm_fullcolor_ff1wfxbnk_logo.png | 2804443 | 2025-06-24 14:54:04 |
| - | 5593669_MatoSpectoru_001_big_coco_b_adult_march_2025_fullcolor_suit_ff1_logo.json | 14974 | 2025-06-24 14:54:01 |
| - | 5593669_MatoSpectoru_001_big_coco_b_adult_march_2025_fullcolor_suit_ff1_logo.png | 2547234 | 2025-06-24 14:54:01 |
| - | 5593672_MatoSpectoru_002_big_coco_b_adult_march_2025_fullcolor_ripped_suit_ff2_fx_logo.json | 14974 | 2025-06-24 14:54:01 |
| - | 5593672_MatoSpectoru_002_big_coco_b_adult_march_2025_fullcolor_ripped_suit_ff2_fx_logo.png | 2556091 | 2025-06-24 14:54:01 |
| - | 5593674_MatoSpectoru_003_big_coco_b_adult_march_2025_fullcolor_ripped_suit_ff3_sw_logo.json | 14974 | 2025-06-24 14:54:01 |
| - | 5593674_MatoSpectoru_003_big_coco_b_adult_march_2025_fullcolor_ripped_suit_ff3_sw_logo.png | 2557528 | 2025-06-24 14:54:01 |
| - | 5593678_MatoSpectoru_001_tristana_fansubstar_poll_march_2025_fullcolor_bikini_ff1_logo.json | 15642 | 2025-06-24 14:53:57 |
| - | 5593678_MatoSpectoru_001_tristana_fansubstar_poll_march_2025_fullcolor_bikini_ff1_logo.png | 2380951 | 2025-06-24 14:53:57 |
| - | 5593679_MatoSpectoru_002_tristana_fansubstar_poll_march_2025_fullcolor_nude_ff2t_logo.json | 15642 | 2025-06-24 14:53:57 |
| - | 5593679_MatoSpectoru_002_tristana_fansubstar_poll_march_2025_fullcolor_nude_ff2t_logo.png | 2383602 | 2025-06-24 14:53:57 |
| - | 5593680_MatoSpectoru_003_tristana_fansubstar_poll_march_2025_fullcolor_nude_ff3sw_logo.json | 15642 | 2025-06-24 14:53:57 |
| - | 5593680_MatoSpectoru_003_tristana_fansubstar_poll_march_2025_fullcolor_nude_ff3sw_logo.png | 2373277 | 2025-06-24 14:53:57 |
| - | 5593687_MatoSpectoru_001_pulchra_p_fanart_poll_march_2025_fullcolor_suit_ff1_logo.json | 14930 | 2025-06-24 14:53:52 |
| - | 5593687_MatoSpectoru_001_pulchra_p_fanart_poll_march_2025_fullcolor_suit_ff1_logo.png | 2414384 | 2025-06-24 14:53:52 |
| - | 5593688_MatoSpectoru_002_pulchra_p_fanart_poll_march_2025_fullcolor_suit_ff2bt_logo.json | 14930 | 2025-06-24 14:53:53 |
| - | 5593688_MatoSpectoru_002_pulchra_p_fanart_poll_march_2025_fullcolor_suit_ff2bt_logo.png | 2420917 | 2025-06-24 14:53:53 |
| - | 5593691_MatoSpectoru_003_pulchra_p_fanart_poll_march_2025_fullcolor_nude_ff1sw_logo.json | 14930 | 2025-06-24 14:53:53 |
| - | 5593691_MatoSpectoru_003_pulchra_p_fanart_poll_march_2025_fullcolor_nude_ff1sw_logo.png | 2349575 | 2025-06-24 14:53:53 |
| - | 5593698_MatoSpectoru_004_ashley_inkling_oc_april_2025_comm_fullcolor_original_ff1_logo.json | 16891 | 2025-06-24 14:53:49 |
| - | 5593698_MatoSpectoru_004_ashley_inkling_oc_april_2025_comm_fullcolor_original_ff1_logo.png | 2985960 | 2025-06-24 14:53:49 |
| - | 5593702_MatoSpectoru_005_ashley_inkling_oc_april_2025_comm_fullcolor_original_ff2t_logo.json | 16891 | 2025-06-24 14:53:49 |
| - | 5593702_MatoSpectoru_005_ashley_inkling_oc_april_2025_comm_fullcolor_original_ff2t_logo.png | 2995534 | 2025-06-24 14:53:49 |
| - | 5593703_MatoSpectoru_001_ashley_inkling_oc_april_2025_comm_fullcolor_ff1b_logo.json | 16891 | 2025-06-24 14:53:49 |
| - | 5593703_MatoSpectoru_001_ashley_inkling_oc_april_2025_comm_fullcolor_ff1b_logo.png | 2998140 | 2025-06-24 14:53:49 |
| - | 5593705_MatoSpectoru_002_ashley_inkling_oc_april_2025_comm_fullcolor_ff2bt_logo.json | 16891 | 2025-06-24 14:53:50 |
| - | 5593705_MatoSpectoru_002_ashley_inkling_oc_april_2025_comm_fullcolor_ff2bt_logo.png | 3007543 | 2025-06-24 14:53:50 |
| - | 5593719_MatoSpectoru_001_melina_mimikyu_oc_april_comm_fullcolor_ff1_logo.json | 14557 | 2025-06-24 14:53:44 |
| - | 5593719_MatoSpectoru_001_melina_mimikyu_oc_april_comm_fullcolor_ff1_logo.png | 1647562 | 2025-06-24 14:53:44 |
| - | 5593722_MatoSpectoru_002_melina_mimikyu_oc_april_comm_fullcolor_ff2bt_logo.json | 14557 | 2025-06-24 14:53:44 |
| - | 5593722_MatoSpectoru_002_melina_mimikyu_oc_april_comm_fullcolor_ff2bt_logo.png | 1701186 | 2025-06-24 14:53:44 |
| - | 5593727_MatoSpectoru_003_melina_mimikyu_oc_april_comm_fullcolor_ff2c_logo.json | 14557 | 2025-06-24 14:53:44 |
| - | 5593727_MatoSpectoru_003_melina_mimikyu_oc_april_comm_fullcolor_ff2c_logo.png | 1673600 | 2025-06-24 14:53:44 |
| - | 5593748_MatoSpectoru_001_shiver_fansubstar_poll_may_2025_fullcolor_suit_a_ff1_logo.json | 17701 | 2025-06-24 14:53:34 |
| - | 5593748_MatoSpectoru_001_shiver_fansubstar_poll_may_2025_fullcolor_suit_a_ff1_logo.png | 2130322 | 2025-06-24 14:53:34 |
| - | 5593750_MatoSpectoru_002_shiver_fansubstar_poll_may_2025_fullcolor_suit_a_ff2p2_logo.json | 17701 | 2025-06-24 14:53:34 |
| - | 5593750_MatoSpectoru_002_shiver_fansubstar_poll_may_2025_fullcolor_suit_a_ff2p2_logo.png | 2181171 | 2025-06-24 14:53:34 |
| - | 5593753_MatoSpectoru_003_shiver_fansubstar_poll_may_2025_fullcolor_suit_a_ff3p2cfx_logo.json | 17701 | 2025-06-24 14:53:35 |
| - | 5593753_MatoSpectoru_003_shiver_fansubstar_poll_may_2025_fullcolor_suit_a_ff3p2cfx_logo.png | 2380192 | 2025-06-24 14:53:35 |
| - | 5593762_MatoSpectoru_004_shiver_fansubstar_poll_may_2025_fullcolor_suit_a_ff4p2c2t_logo.json | 17701 | 2025-06-24 14:53:35 |
| - | 5593762_MatoSpectoru_004_shiver_fansubstar_poll_may_2025_fullcolor_suit_a_ff4p2c2t_logo.png | 2281785 | 2025-06-24 14:53:35 |
| - | 5593786_MatoSpectoru_coco_tawna_june_2025_fullcolor_ff1fx_logo.json | 13162 | 2025-06-24 14:53:28 |
| - | 5593786_MatoSpectoru_coco_tawna_june_2025_fullcolor_ff1fx_logo.png | 3008607 | 2025-06-24 14:53:28 |
| - | 5593787_MatoSpectoru_coco_tawna_june_2025_fullcolor_ff2btsw_logo.json | 13162 | 2025-06-24 14:53:29 |
| - | 5593787_MatoSpectoru_coco_tawna_june_2025_fullcolor_ff2btsw_logo.png | 3083977 | 2025-06-24 14:53:29 |
| - | 5602702_MatoSpectoru_001_morgana_p5_june_2025_fullcolor_ff1blt_logo.json | 15984 | 2025-06-24 12:55:43 |
| - | 5602702_MatoSpectoru_001_morgana_p5_june_2025_fullcolor_ff1blt_logo.png | 1561743 | 2025-06-24 12:55:43 |
| - | 5602706_MatoSpectoru_002_morgana_p5_june_2025_fullcolor_ff2bltt_logo.json | 15984 | 2025-06-24 12:55:43 |
| - | 5602706_MatoSpectoru_002_morgana_p5_june_2025_fullcolor_ff2bltt_logo.png | 1552186 | 2025-06-24 12:55:43 |
| - | 5602707_MatoSpectoru_003_morgana_p5_june_2025_fullcolor_ff4bltt_logo.json | 15984 | 2025-06-24 12:55:44 |
| - | 5602707_MatoSpectoru_003_morgana_p5_june_2025_fullcolor_ff4bltt_logo.png | 1540167 | 2025-06-24 12:55:44 |
| - | 5602709_MatoSpectoru_004_morgana_p5_june_2025_fullcolor_ff3bblttb_logo.json | 15984 | 2025-06-24 12:55:44 |
| - | 5602709_MatoSpectoru_004_morgana_p5_june_2025_fullcolor_ff3bblttb_logo.png | 1547444 | 2025-06-24 12:55:44 |
| - | 5674276_MatoSpectoru_001_cate_meowdy_june_2025_fullcolor_suit_b_ff1bnpswp_logo.json | 14988 | 2025-08-10 20:25:49 |
| - | 5674276_MatoSpectoru_001_cate_meowdy_june_2025_fullcolor_suit_b_ff1bnpswp_logo.png | 1729230 | 2025-08-10 20:25:49 |
| - | 5674277_MatoSpectoru_002_cate_meowdy_june_2025_fullcolor_suit_b_ff1anpswpt_logo.json | 14988 | 2025-08-10 20:25:49 |
| - | 5674277_MatoSpectoru_002_cate_meowdy_june_2025_fullcolor_suit_b_ff1anpswpt_logo.png | 1794429 | 2025-08-10 20:25:49 |
| - | 5674281_MatoSpectoru_cate_meowdy_june_2025_fullcolor_p_promotion_3.0.json | 14988 | 2025-08-10 20:25:49 |
| - | 5674281_MatoSpectoru_cate_meowdy_june_2025_fullcolor_p_promotion_3.0.png | 695594 | 2025-08-10 20:25:49 |
| - | 5674283_MatoSpectoru_cate_meowdy_june_2025_fullcolor_steps_blur.json | 14988 | 2025-08-10 20:25:49 |
| - | 5674283_MatoSpectoru_cate_meowdy_june_2025_fullcolor_steps_blur.png | 845954 | 2025-08-10 20:25:49 |
| - | 5674296_MatoSpectoru_001_ruto_oot_fansubstar_poll_june_2025_fullcolor_nude_f1_logo.json | 15221 | 2025-08-10 20:25:34 |
| - | 5674296_MatoSpectoru_001_ruto_oot_fansubstar_poll_june_2025_fullcolor_nude_f1_logo.png | 2053168 | 2025-08-10 20:25:34 |
| - | 5674297_MatoSpectoru_003_ruto_oot_fansubstar_poll_june_2025_fullcolor_nude_f1swt_logo.json | 15221 | 2025-08-10 20:25:35 |
| - | 5674297_MatoSpectoru_003_ruto_oot_fansubstar_poll_june_2025_fullcolor_nude_f1swt_logo.png | 2225534 | 2025-08-10 20:25:35 |
| - | 5674303_MatoSpectoru_poppy_kong_dkb_july_2025_fullcolor_suit_ff1gl_sweat_logo.json | 17245 | 2025-08-10 20:25:25 |
| - | 5674303_MatoSpectoru_poppy_kong_dkb_july_2025_fullcolor_suit_ff1gl_sweat_logo.png | 789221 | 2025-08-10 20:25:25 |
| - | 5674305_MatoSpectoru_poppy_kong_dkb_july_2025_fullcolor_suit_ff1gl_sweatt_logo.json | 17245 | 2025-08-10 20:25:25 |
| - | 5674305_MatoSpectoru_poppy_kong_dkb_july_2025_fullcolor_suit_ff1gl_sweatt_logo.png | 828671 | 2025-08-10 20:25:25 |
| - | 5674309_MatoSpectoru_poppy_kong_dkb_july_2025_fullcolor_suit_ff1glbnn_sweatt_logo.json | 17245 | 2025-08-10 20:25:26 |
| - | 5674309_MatoSpectoru_poppy_kong_dkb_july_2025_fullcolor_suit_ff1glbnn_sweatt_logo.png | 835600 | 2025-08-10 20:25:26 |
| - | 5674312_MatoSpectoru_ruto_oot_fansubstar_june_2025_fullcolor_p_promotion_3.0_b.json | 15221 | 2025-08-10 20:25:35 |
| - | 5674312_MatoSpectoru_ruto_oot_fansubstar_june_2025_fullcolor_p_promotion_3.0_b.png | 554966 | 2025-08-10 20:25:35 |
| - | 5674314_MatoSpectoru_ruto_oot_fansubstar_poll_june_2025_fullcolor_steps_blur.json | 15221 | 2025-08-10 20:25:35 |
| - | 5674314_MatoSpectoru_ruto_oot_fansubstar_poll_june_2025_fullcolor_steps_blur.png | 600736 | 2025-08-10 20:25:35 |
| - | 5674315_MatoSpectoru_template_exclusive_patreon_3.0_poppy_kong_dkb_july_2025.json | 17245 | 2025-08-10 20:25:26 |
| - | 5674315_MatoSpectoru_template_exclusive_patreon_3.0_poppy_kong_dkb_july_2025.png | 606110 | 2025-08-10 20:25:26 |
| - | 5674318_MatoSpectoru_poppy_kong_dkb_july_2025_fullcolor_steps_blur.json | 17245 | 2025-08-10 20:25:26 |
| - | 5674318_MatoSpectoru_poppy_kong_dkb_july_2025_fullcolor_steps_blur.png | 396765 | 2025-08-10 20:25:26 |
| - | 5674320_MatoSpectoru_rouge_august_2025_fullcolor_nude_ff1a_mouth_3_clap_logo.json | 15039 | 2025-08-10 20:25:16 |
| - | 5674320_MatoSpectoru_rouge_august_2025_fullcolor_nude_ff1a_mouth_3_clap_logo.png | 570335 | 2025-08-10 20:25:16 |
| - | 5674322_MatoSpectoru_rouge_august_2025_fullcolor_suit_ff1a_clap_fx_mouth_1_t_logo.json | 15039 | 2025-08-10 20:25:16 |
| - | 5674322_MatoSpectoru_rouge_august_2025_fullcolor_suit_ff1a_clap_fx_mouth_1_t_logo.png | 651291 | 2025-08-10 20:25:16 |
| - | 5674326_MatoSpectoru_rouge_august_template_exclusive_patreon_3.0_long_4x4.json | 15039 | 2025-08-10 20:25:16 |
| - | 5674326_MatoSpectoru_rouge_august_template_exclusive_patreon_3.0_long_4x4.png | 731695 | 2025-08-10 20:25:16 |
| - | 5674328_MatoSpectoru_rouge_august_2025_fullcolor_steps_blur.json | 15039 | 2025-08-10 20:25:16 |
| - | 5674328_MatoSpectoru_rouge_august_2025_fullcolor_steps_blur.png | 290430 | 2025-08-10 20:25:16 |
| - | 5674334_MatoSpectoru_001_lammy_um_jammer_lammy_august_2025_fullcolor_lammy_ff1_logo.json | 15162 | 2025-08-10 20:25:01 |
| - | 5674334_MatoSpectoru_001_lammy_um_jammer_lammy_august_2025_fullcolor_lammy_ff1_logo.png | 568777 | 2025-08-10 20:25:01 |
| - | 5674336_MatoSpectoru_002_lammy_um_jammer_lammy_august_2025_fullcolor_lammy_ff1t_logo.json | 15162 | 2025-08-10 20:25:01 |
| - | 5674336_MatoSpectoru_002_lammy_um_jammer_lammy_august_2025_fullcolor_lammy_ff1t_logo.png | 790029 | 2025-08-10 20:25:01 |
| - | 5674338_MatoSpectoru_lammy_rammy_template_exclusive_patreon_3.0_long_4x4_lr.json | 15162 | 2025-08-10 20:25:02 |
| - | 5674338_MatoSpectoru_lammy_rammy_template_exclusive_patreon_3.0_long_4x4_lr.png | 823103 | 2025-08-10 20:25:02 |
| - | 5674340_MatoSpectoru_lammy_um_jammer_lammy_august_2025_fullcolor_lammy_steps_blur.json | 15162 | 2025-08-10 20:25:02 |
| - | 5674340_MatoSpectoru_lammy_um_jammer_lammy_august_2025_fullcolor_lammy_steps_blur.png | 301620 | 2025-08-10 20:25:02 |
| - | 5681550_MatoSpectoru_003_big_blaze_the_cat_august_2025_fullcolor_bikini_ff2swtfx_logo.json | 13458 | 2025-08-16 23:26:24 |
| - | 5681550_MatoSpectoru_003_big_blaze_the_cat_august_2025_fullcolor_bikini_ff2swtfx_logo.png | 2351563 | 2025-08-16 23:26:24 |
| - | 5681552_MatoSpectoru_big_blaze_the_cat_exclusive_patreon_3.0_long_marco_3x3_short_lr.json | 13458 | 2025-08-16 23:26:24 |
| - | 5681552_MatoSpectoru_big_blaze_the_cat_exclusive_patreon_3.0_long_marco_3x3_short_lr.png | 664009 | 2025-08-16 23:26:24 |
| - | 5681553_MatoSpectoru_big_blaze_the_cat_august_2025_fullcolor_steps_blur.json | 13458 | 2025-08-16 23:26:24 |
| - | 5681553_MatoSpectoru_big_blaze_the_cat_august_2025_fullcolor_steps_blur.png | 129618 | 2025-08-16 23:26:24 |
| - | 5717023_MatoSpectoru_002_konqi_august_2025_patreon_comm_fullcolor_nude_ff2t_logo.json | 13083 | 2025-09-14 07:45:15 |
| - | 5717023_MatoSpectoru_002_konqi_august_2025_patreon_comm_fullcolor_nude_ff2t_logo.png | 1908754 | 2025-09-14 07:45:15 |
| - | 5717026_MatoSpectoru_002_morgana_p5_fwp3_august_2025_fullcolor_ff3bt_logo.json | 14024 | 2025-09-14 07:45:11 |
| - | 5717026_MatoSpectoru_002_morgana_p5_fwp3_august_2025_fullcolor_ff3bt_logo.png | 1959205 | 2025-09-14 07:45:11 |
| - | 5717027_MatoSpectoru_006_morgana_p5_fwp3_august_2025_fullcolor_ff2bt_logo.json | 14024 | 2025-09-14 07:45:11 |
| - | 5717027_MatoSpectoru_006_morgana_p5_fwp3_august_2025_fullcolor_ff2bt_logo.png | 1960450 | 2025-09-14 07:45:11 |
| - | 5717030_MatoSpectoru_001_hornet_hk_september_2025_fullcolor_ff1_logo.json | 14566 | 2025-09-14 07:45:07 |
| - | 5717030_MatoSpectoru_001_hornet_hk_september_2025_fullcolor_ff1_logo.png | 2901053 | 2025-09-14 07:45:07 |
| - | 5717031_MatoSpectoru_002_hornet_hk_september_2025_fullcolor_ff1t_logo.json | 14566 | 2025-09-14 07:45:07 |
| - | 5717031_MatoSpectoru_002_hornet_hk_september_2025_fullcolor_ff1t_logo.png | 2978763 | 2025-09-14 07:45:07 |
| - | 5717042_MatoSpectoru_004_hornet_2_hk_september_2025_fullcolor_ff2swt_logo.json | 12659 | 2025-09-14 07:44:59 |
| - | 5717042_MatoSpectoru_004_hornet_2_hk_september_2025_fullcolor_ff2swt_logo.png | 1908396 | 2025-09-14 07:44:59 |
| - | 5717043_MatoSpectoru_konqi_august_2025_patreon_comm_fullcolor_4x_lr.json | 13083 | 2025-09-14 07:45:15 |
| - | 5717043_MatoSpectoru_konqi_august_2025_patreon_comm_fullcolor_4x_lr.png | 803497 | 2025-09-14 07:45:15 |
| - | 5717044_MatoSpectoru_konqi_august_2025_patreon_comm_fullcolor_steps_blur.json | 13083 | 2025-09-14 07:45:15 |
| - | 5717044_MatoSpectoru_konqi_august_2025_patreon_comm_fullcolor_steps_blur.png | 368292 | 2025-09-14 07:45:15 |
| - | 5717045_MatoSpectoru_morgana_p5_fwp3_august_2025_fullcolor_exclusove_4x_patreon_xlr.json | 14024 | 2025-09-14 07:45:11 |
| - | 5717045_MatoSpectoru_morgana_p5_fwp3_august_2025_fullcolor_exclusove_4x_patreon_xlr.png | 392751 | 2025-09-14 07:45:11 |
| - | 5717047_MatoSpectoru_morgana_p5_fwp3_august_2025_fullcolor_steps_blur.json | 14024 | 2025-09-14 07:45:11 |
| - | 5717047_MatoSpectoru_morgana_p5_fwp3_august_2025_fullcolor_steps_blur.png | 133778 | 2025-09-14 07:45:11 |
| - | 5717050_MatoSpectoru_hornet_hk_september_2025_fullcolor_exclusive_2x.json | 14566 | 2025-09-14 07:45:07 |
| - | 5717050_MatoSpectoru_hornet_hk_september_2025_fullcolor_exclusive_2x.png | 483037 | 2025-09-14 07:45:07 |
| - | 5717052_MatoSpectoru_hornet_hk_september_2025_fullcolor_steps_blur.json | 14566 | 2025-09-14 07:45:07 |
| - | 5717052_MatoSpectoru_hornet_hk_september_2025_fullcolor_steps_blur.png | 621768 | 2025-09-14 07:45:07 |
| - | 5717054_MatoSpectoru_hornet_2_hk_september_2025_fullcolor_2x_exclusive_patreon.json | 12659 | 2025-09-14 07:44:59 |
| - | 5717054_MatoSpectoru_hornet_2_hk_september_2025_fullcolor_2x_exclusive_patreon.png | 290248 | 2025-09-14 07:44:59 |
| - | 5717060_MatoSpectoru_hornet_2_hk_september_2025_fullcolor_steps_blur.json | 12659 | 2025-09-14 07:44:59 |
| - | 5717060_MatoSpectoru_hornet_2_hk_september_2025_fullcolor_steps_blur.png | 566658 | 2025-09-14 07:44:59 |
| - | 5717061_MatoSpectoru_001_judy_hopps_z_fwp6_september_2025_fullcolor_ff1m2ts_logo.json | 15018 | 2025-09-14 07:44:50 |
| - | 5717061_MatoSpectoru_001_judy_hopps_z_fwp6_september_2025_fullcolor_ff1m2ts_logo.png | 1974706 | 2025-09-14 07:44:50 |
| - | 5717062_MatoSpectoru_002_judy_hopps_z_fwp6_september_2025_fullcolor_ff1m1tst_logo.json | 15018 | 2025-09-14 07:44:50 |
| - | 5717062_MatoSpectoru_002_judy_hopps_z_fwp6_september_2025_fullcolor_ff1m1tst_logo.png | 2033567 | 2025-09-14 07:44:50 |
| - | 5717066_MatoSpectoru_judy_hopps_z_fwp6_september_2025_x2_exclusive.json | 15018 | 2025-09-14 07:44:51 |
| - | 5717066_MatoSpectoru_judy_hopps_z_fwp6_september_2025_x2_exclusive.png | 658445 | 2025-09-14 07:44:51 |
| - | 5717068_MatoSpectoru_judy_hopps_z_fwp6_september_2025_fullcolor_steps_blur.json | 15018 | 2025-09-14 07:44:51 |
| - | 5717068_MatoSpectoru_judy_hopps_z_fwp6_september_2025_fullcolor_steps_blur.png | 476045 | 2025-09-14 07:44:51 |
| - | 576492_MatoSpectoru_blaziken_color_final.json | 5879 | 2025-04-21 13:33:16 |
| - | 576492_MatoSpectoru_blaziken_color_final.png | 680470 | 2025-04-21 13:33:16 |
| - | 585968_MatoSpectoru_proxy_pizzacat_ps_f_b.jpg | 442689 | 2025-04-21 16:08:08 |
| - | 585968_MatoSpectoru_proxy_pizzacat_ps_f_b.json | 6498 | 2025-04-21 16:08:08 |
| - | 587814_MatoSpectoru_polly_esther_pizzacat_hair_and_helm_ps_helm_b_lr_n.json | 11002 | 2025-04-21 16:41:20 |
| - | 587814_MatoSpectoru_polly_esther_pizzacat_hair_and_helm_ps_helm_b_lr_n.png | 442761 | 2025-04-21 16:41:20 |
| - | 587815_MatoSpectoru_polly_esther_pizzacat_hair_and_helm_ps_hair_b_lr_n.json | 11002 | 2025-04-21 16:41:20 |
| - | 587815_MatoSpectoru_polly_esther_pizzacat_hair_and_helm_ps_hair_b_lr_n.png | 393188 | 2025-04-21 16:41:20 |
| - | 602724_MatoSpectoru_midna_mastur_ps_lr.json | 7054 | 2025-04-21 20:52:42 |
| - | 602724_MatoSpectoru_midna_mastur_ps_lr.png | 347374 | 2025-04-21 20:52:42 |
| - | 616664_MatoSpectoru_shizue_acnl_psb_lr.json | 6241 | 2025-04-22 00:51:00 |
| - | 616664_MatoSpectoru_shizue_acnl_psb_lr.png | 366504 | 2025-04-22 00:51:00 |
| - | 648156_MatoSpectoru_gardevoir___gothitelle_ps_lr_c.json | 8626 | 2025-04-13 04:09:43 |
| - | 648156_MatoSpectoru_gardevoir___gothitelle_ps_lr_c.png | 155607 | 2025-04-13 04:09:43 |
| - | 648157_MatoSpectoru_gardevoir___gothitelle_ps_lr_b.json | 8626 | 2025-04-13 04:09:43 |
| - | 648157_MatoSpectoru_gardevoir___gothitelle_ps_lr_b.png | 401218 | 2025-04-13 04:09:43 |
| - | 658028_MatoSpectoru_midna_footjob_clr_ps_final_b.json | 12017 | 2025-04-13 06:39:41 |
| - | 658028_MatoSpectoru_midna_footjob_clr_ps_final_b.png | 356903 | 2025-04-13 06:39:41 |
| - | 658029_MatoSpectoru_midna_footjob_lnrt_ps_final_b.json | 12017 | 2025-04-13 06:39:41 |
| - | 658029_MatoSpectoru_midna_footjob_lnrt_ps_final_b.png | 154086 | 2025-04-13 06:39:41 |
| - | 658030_MatoSpectoru_midna_footjob_clr_ps_final_b_b_w.json | 12017 | 2025-04-13 06:39:41 |
| - | 658030_MatoSpectoru_midna_footjob_clr_ps_final_b_b_w.png | 134799 | 2025-04-13 06:39:41 |
| - | 661420_MatoSpectoru_rouge_the_bat_lineart_clr_psb.json | 7096 | 2025-04-13 07:32:29 |
| - | 661420_MatoSpectoru_rouge_the_bat_lineart_clr_psb.png | 321138 | 2025-04-13 07:32:29 |
| - | 676148_MatoSpectoru_medli__edit_ps__lrc.json | 6413 | 2025-04-13 11:24:54 |
| - | 676148_MatoSpectoru_medli__edit_ps__lrc.png | 408504 | 2025-04-13 11:24:54 |
| - | 677027_MatoSpectoru_reese_ac__edit_ps__lrb.json | 9508 | 2025-04-13 11:38:09 |
| - | 677027_MatoSpectoru_reese_ac__edit_ps__lrb.png | 198128 | 2025-04-13 11:38:09 |
| - | 677029_MatoSpectoru_reese_ac__edit_ps__naked_lrb.json | 9508 | 2025-04-13 11:38:10 |
| - | 677029_MatoSpectoru_reese_ac__edit_ps__naked_lrb.png | 177453 | 2025-04-13 11:38:10 |
| - | 677146_MatoSpectoru_midna_dat_ass_color__edit_sai__lrb_ps.json | 11118 | 2025-04-13 10:59:36 |
| - | 677146_MatoSpectoru_midna_dat_ass_color__edit_sai__lrb_ps.png | 309454 | 2025-04-13 10:59:36 |
| - | 677150_MatoSpectoru_midna_dat_ass_color__edit_sai__lrb_ps_lineart.json | 11118 | 2025-04-13 10:59:36 |
| - | 677150_MatoSpectoru_midna_dat_ass_color__edit_sai__lrb_ps_lineart.png | 52253 | 2025-04-13 10:59:36 |
| - | 701646_MatoSpectoru_midna_no_subway_psbc.json | 5868 | 2025-04-13 17:45:09 |
| - | 701646_MatoSpectoru_midna_no_subway_psbc.png | 518836 | 2025-04-13 17:45:09 |
| - | 703928_MatoSpectoru_blaze_the_cat_new_color_lr_sai_2_psb_2_final_d.json | 6451 | 2025-04-13 18:23:04 |
| - | 703928_MatoSpectoru_blaze_the_cat_new_color_lr_sai_2_psb_2_final_d.png | 405452 | 2025-04-13 18:23:04 |
| - | 773797_MatoSpectoru_pururun_gift_l_pslr_a2_lrbxxx_.json | 7905 | 2025-04-23 13:56:26 |
| - | 773797_MatoSpectoru_pururun_gift_l_pslr_a2_lrbxxx_.png | 454285 | 2025-04-23 13:56:26 |
| - | 787800_MatoSpectoru_twilight__edit_ps__b.json | 6098 | 2025-04-23 18:00:37 |
| - | 787800_MatoSpectoru_twilight__edit_ps__b.png | 570643 | 2025-04-23 18:00:37 |
| - | 793239_MatoSpectoru_taokaka_18__2014_ps_c.json | 5437 | 2025-04-23 20:20:53 |
| - | 793239_MatoSpectoru_taokaka_18__2014_ps_c.png | 794378 | 2025-04-23 20:20:53 |
| - | 805577_MatoSpectoru_midna_anal_18__2014_acoplado__edit_ps__2_sai_2_final_no_yes_lrd.json | 7778 | 2025-04-23 23:42:10 |
| - | 805577_MatoSpectoru_midna_anal_18__2014_acoplado__edit_ps__2_sai_2_final_no_yes_lrd.png | 866491 | 2025-04-23 23:42:10 |
| - | A Big Royal Mummy Cat.json | 10185 | 2023-04-02 11:09:31 |
| - | A Big Royal Mummy Cat[0].png | 542900 | 2023-04-02 11:09:31 |
| - | A Big Royal Mummy Cat[1].png | 457734 | 2023-04-02 11:09:32 |
| - | A bit of quiet time~ 💛.json | 12123 | 2023-08-20 11:15:04 |
| - | A bit of quiet time~ 💛[0].png | 1825286 | 2023-08-20 11:15:04 |
| - | A bit of quiet time~ 💛[1].png | 1854398 | 2023-08-20 11:15:04 |
| - | A bit of quiet time~ 💛[2].png | 1836636 | 2023-08-20 11:15:05 |
| - | A mothers big surprise 💓.json | 11971 | 2023-04-02 11:16:06 |
| - | A mothers big surprise 💓[0].png | 558432 | 2023-04-02 11:16:06 |
| - | A mothers big surprise 💓[1].png | 569857 | 2023-04-02 11:16:06 |
| - | A mothers big surprise 💓[2].png | 578242 | 2023-04-02 11:16:07 |
| - | A nice hug 🤗.json | 11739 | 2023-08-02 10:15:32 |
| - | A nice hug 🤗[0].png | 771283 | 2023-08-02 10:15:31 |
| - | A nice hug 🤗[1].png | 758496 | 2023-08-02 10:15:32 |
| - | A nice hug 🤗[2].png | 771414 | 2023-08-02 10:15:32 |
| - | Abigail White [Comm].json | 6617 | 2018-11-23 13:16:49 |
| - | Abigail White [Comm].png | 1473563 | 2018-11-23 13:16:50 |
| - | Acaisha the Cat - OC [Comm].json | 7771 | 2020-09-08 17:12:42 |
| - | Acaisha the Cat - OC [Comm].png | 517893 | 2020-09-08 17:12:44 |
| - | Adelia - HB.json | 7674 | 2019-02-17 01:42:09 |
| - | Adelia - HB.png | 784344 | 2019-02-17 01:42:09 |
| - | Akane [Comm].json | 7585 | 2020-03-13 19:28:00 |
| - | Akane [Comm].png | 840196 | 2020-03-13 19:28:00 |
| - | Akeno Bee [Comm].json | 11222 | 2021-10-25 01:26:12 |
| - | Akeno Bee [Comm][0].png | 892382 | 2021-10-25 01:26:12 |
| - | Akeno Bee [Comm][1].png | 888566 | 2021-10-25 01:26:13 |
| - | Alice & Nila - HAPPY HALLOWEEN!.json | 7282 | 2018-11-22 17:05:22 |
| - | Alice Renimpmon [Comm].json | 11471 | 2021-04-13 03:19:49 |
| - | Alice Renimpmon [Comm][0].png | 657029 | 2021-04-13 03:19:49 |
| - | Alice Renimpmon [Comm][1].png | 617841 | 2021-04-13 03:19:51 |
| - | Alice Sheepstar (Original) [Normal _ Futa Version].json | 15246 | 2018-11-23 14:31:08 |
| - | Alice Sheepstar (Original) [Normal _ Futa Version][0].png | 547851 | 2018-11-23 14:31:07 |
| - | Alice Sheepstar (Original) [Normal _ Futa Version][1].png | 609169 | 2018-11-23 14:31:08 |
| - | Alice Sheepstar (Original) [Normal _ Futa Version][2].png | 434244 | 2018-11-23 14:31:08 |
| - | Alice Sheepstar (Original) [Normal _ Futa Version][3].png | 497300 | 2018-11-23 14:31:08 |
| - | Alice Sheepstar - Futanari, Love & Chocolate.json | 11609 | 2019-04-16 01:25:15 |
| - | Alice Sheepstar - Futanari, Love & Chocolate[0].png | 1465164 | 2019-04-16 01:25:15 |
| - | Alice Sheepstar - Futanari, Love & Chocolate[1].png | 1459597 | 2019-04-16 01:25:16 |
| - | Alice Sheepstar - My OC.json | 19044 | 2018-11-22 13:09:40 |
| - | Alice Sheepstar X Frapter Bracllard [Patreon Comm].json | 12342 | 2020-01-11 16:43:52 |
| - | Alice Sheepstar X Frapter Bracllard [Patreon Comm][0].png | 727191 | 2020-01-11 16:43:52 |
| - | Alice Sheepstar X Frapter Bracllard [Patreon Comm][1].png | 762763 | 2020-01-11 16:43:52 |
| - | Alice Sheepstar [Patreon Comm].json | 10986 | 2020-01-11 12:29:31 |
| - | Alice Sheepstar [Patreon Comm][0].png | 656288 | 2020-01-11 12:29:31 |
| - | Alice Sheepstar [Patreon Comm][1].png | 678115 | 2020-01-11 12:29:31 |
| - | Alisa'Tanguna - Character Sheet [Comm].json | 12177 | 2021-01-09 04:30:33 |
| - | Alisa'Tanguna - Character Sheet [Comm][0].png | 584798 | 2021-01-09 04:30:33 |
| - | Alisa'Tanguna - Character Sheet [Comm][1].png | 523945 | 2021-01-09 04:30:34 |
| - | Alphys - Commission.json | 9469 | 2018-11-22 07:54:34 |
| - | Alphys secret experiment [Comm].json | 14059 | 2020-10-23 01:08:16 |
| - | Alphys secret experiment [Comm][0].png | 401237 | 2020-10-23 01:08:15 |
| - | Alphys secret experiment [Comm][1].png | 422741 | 2020-10-23 01:08:16 |
| - | Alphys secret experiment [Comm][2].png | 440700 | 2020-10-23 01:08:16 |
| - | Alphys secret experiment [Comm][3].png | 398000 | 2020-10-23 01:08:17 |
| - | Amiga😜💦🎶.json | 18170 | 2022-04-20 10:21:07 |
| - | Amiga😜💦🎶[0].png | 1202600 | 2022-04-20 10:21:06 |
| - | Amiga😜💦🎶[1].png | 1243079 | 2022-04-20 10:21:07 |
| - | Amiga😜💦🎶[2].png | 1186329 | 2022-04-20 10:21:07 |
| - | Amiga😜💦🎶[3].png | 1243200 | 2022-04-20 10:21:07 |
| - | Amiga😜💦🎶[4].png | 1263780 | 2022-04-20 10:21:07 |
| - | Amiga😜💦🎶[5].png | 1233574 | 2022-04-20 10:21:08 |
| - | Amina Moroboshi - Commission.json | 9369 | 2018-11-22 00:43:46 |
| - | Amy Has Something to Steal [Comm].json | 18728 | 2020-09-30 09:19:12 |
| - | Amy Has Something to Steal [Comm][0].png | 252486 | 2020-09-30 09:19:07 |
| - | Amy Has Something to Steal [Comm][1].png | 255057 | 2020-09-30 09:19:08 |
| - | Amy Has Something to Steal [Comm][2].png | 263202 | 2020-09-30 09:19:09 |
| - | Amy Has Something to Steal [Comm][3].png | 278248 | 2020-09-30 09:19:10 |
| - | Amy Has Something to Steal [Comm][4].png | 287666 | 2020-09-30 09:19:12 |
| - | Amy Has Something to Steal [Comm][5].png | 305780 | 2020-09-30 09:19:13 |
| - | Amy Rose & Metal Sonic.json | 8043 | 2019-02-01 00:57:16 |
| - | Amy Rose & Metal Sonic.png | 873253 | 2019-02-01 00:57:16 |
| - | Amy Rose - FCS 1 [2017].json | 6476 | 2018-11-21 18:51:02 |
| - | Amy Rose X Fox McCloud - Commission.json | 7410 | 2018-11-22 04:04:55 |
| - | Amy Rose 🌭 [Comm].json | 14590 | 2020-01-12 04:04:45 |
| - | Amy Rose 🌭 [Comm][0].png | 668606 | 2020-01-12 04:04:45 |
| - | Amy Rose 🌭 [Comm][1].png | 672804 | 2020-01-12 04:04:45 |
| - | Amy Rose 🌭 [Comm][2].png | 626824 | 2020-01-12 04:04:45 |
| - | Amy Rose 🌭 [Comm][3].png | 630957 | 2020-01-12 04:04:46 |
| - | Amy Rose.json | 4577 | 2018-11-18 21:41:48 |
| - | Amy and Friends~ 🍆[Comm].json | 12941 | 2020-01-12 12:18:26 |
| - | Amy and Friends~ 🍆[Comm][0].png | 794659 | 2020-01-12 12:18:25 |
| - | Amy and Friends~ 🍆[Comm][1].png | 942571 | 2020-01-12 12:18:26 |
| - | Amy and Friends~ 🍆[Comm][2].png | 974178 | 2020-01-12 12:18:26 |
| - | Amy's Growth Spurt 🍈🍈 [Comm].json | 7489 | 2020-01-12 04:10:13 |
| - | Amy's Growth Spurt 🍈🍈 [Comm].png | 773587 | 2020-01-12 04:10:14 |
| - | Amy's Growth Spurt 🍈🍈 [Patreon Comm].json | 8328 | 2019-09-27 23:23:05 |
| - | Amy's Growth Spurt 🍈🍈 [Patreon Comm].png | 785678 | 2019-09-27 23:23:05 |
| - | Amy's Protein Injection 😏🥛 [Patreon Comm].json | 11561 | 2020-01-12 09:53:21 |
| - | Amy's Protein Injection 😏🥛 [Patreon Comm][0].png | 627977 | 2020-01-12 09:53:21 |
| - | Amy's Protein Injection 😏🥛 [Patreon Comm][1].png | 687205 | 2020-01-12 09:53:21 |
| - | Ankhass [Comm].json | 8519 | 2022-02-27 11:57:52 |
| - | Ankhass [Comm].png | 1586231 | 2022-02-27 11:57:52 |
| - | Ann Maren (18+).json | 16049 | 2020-01-12 13:29:02 |
| - | Ann Maren (18+)[0].png | 336462 | 2020-01-12 13:29:01 |
| - | Ann Maren (18+)[1].png | 370918 | 2020-01-12 13:29:01 |
| - | Ann Maren (18+)[2].png | 382468 | 2020-01-12 13:29:02 |
| - | Ann Maren (18+)[3].png | 401911 | 2020-01-12 13:29:02 |
| - | Ann Maren (18+)[4].png | 410747 | 2020-01-12 13:29:02 |
| - | Applejack - Commission.json | 7185 | 2018-11-22 07:28:18 |
| - | Aqualine - Gift.json | 6904 | 2018-11-22 18:31:33 |
| - | Are you hungry? 🍕.json | 8452 | 2024-06-05 10:41:52 |
| - | Are you hungry? 🍕.png | 2122703 | 2024-06-05 10:41:53 |
| - | Asayi - OC [Comm].json | 10940 | 2021-03-06 19:40:34 |
| - | Asayi - OC [Comm][0].png | 376120 | 2021-03-06 19:40:34 |
| - | Asayi - OC [Comm][1].png | 383907 | 2021-03-06 19:40:35 |
| - | Ashley - Pirate enforcer (Mermaid _ Salamander form) [Comm].json | 11024 | 2020-07-08 18:30:06 |
| - | Ashley - Pirate enforcer (Mermaid _ Salamander form) [Comm][0].png | 732648 | 2020-07-08 18:30:06 |
| - | Ashley - Pirate enforcer (Mermaid _ Salamander form) [Comm][1].png | 680117 | 2020-07-08 18:30:09 |
| - | Ass Hunter 😺.json | 9719 | 2023-04-02 11:11:03 |
| - | Ass Hunter 😺[0].png | 574071 | 2023-04-02 11:11:03 |
| - | Ass Hunter 😺[1].png | 533750 | 2023-04-02 11:11:03 |
| - | Ava [Comm].json | 10079 | 2020-06-24 01:41:06 |
| - | Ava [Comm][0].png | 467801 | 2020-06-24 01:41:06 |
| - | Ava [Comm][1].png | 509643 | 2020-06-24 01:41:07 |
| - | Ayako Chives X Hui-Min [Comm].json | 10867 | 2018-11-24 07:17:24 |
| - | Ayako Chives X Hui-Min [Comm][0].png | 867384 | 2018-11-24 07:17:24 |
| - | Ayako Chives X Hui-Min [Comm][1].png | 877856 | 2018-11-24 07:17:25 |
| - | Azure Aura 2 [Comm].json | 7164 | 2018-11-24 08:37:22 |
| - | Azure Aura 2 [Comm].png | 438051 | 2018-11-24 08:37:22 |
| - | Azure Aura [Comm].json | 7307 | 2018-11-24 04:14:20 |
| - | Azure Aura [Comm].png | 510364 | 2018-11-24 04:14:22 |
| - | BIG Conductor's wife 💗.json | 14842 | 2024-06-30 11:25:22 |
| - | BIG Conductor's wife 💗[0].png | 1715417 | 2024-06-30 11:25:22 |
| - | BIG Conductor's wife 💗[1].png | 1698707 | 2024-06-30 11:25:22 |
| - | BIG Conductor's wife 💗[2].png | 1684499 | 2024-06-30 11:25:22 |
| - | BIG Dazzy 🫨💦.json | 10849 | 2024-06-05 10:09:21 |
| - | BIG Dazzy 🫨💦[0].png | 1662469 | 2024-06-05 10:09:21 |
| - | BIG Dazzy 🫨💦[1].png | 1667093 | 2024-06-05 10:09:22 |
| - | BIG Double Battle 🫨💦.json | 12584 | 2024-06-05 10:08:56 |
| - | BIG Double Battle 🫨💦[0].png | 4973577 | 2024-06-05 10:08:56 |
| - | BIG Double Battle 🫨💦[1].png | 4997357 | 2024-06-05 10:08:56 |
| - | BIG Double Battle 🫨💦[2].png | 5044625 | 2024-06-05 10:08:57 |
| - | BIG Feliciass (=ↀωↀ= )💦.json | 14058 | 2024-06-05 10:11:09 |
| - | BIG Feliciass (=ↀωↀ= )💦[0].png | 2135778 | 2024-06-05 10:11:08 |
| - | BIG Feliciass (=ↀωↀ= )💦[1].png | 2118133 | 2024-06-05 10:11:09 |
| - | BIG Feliciass (=ↀωↀ= )💦[2].png | 2123310 | 2024-06-05 10:11:10 |
| - | BIG Fenneko 👀 💦.json | 11764 | 2024-01-03 11:19:50 |
| - | BIG Fenneko 👀 💦[0].png | 1749923 | 2024-01-03 11:19:50 |
| - | BIG Fenneko 👀 💦[1].png | 1843130 | 2024-01-03 11:19:50 |
| - | BIG Fenneko 👀 💦[2].png | 1869520 | 2024-01-03 11:19:50 |
| - | BIG Happy Easter! 🐰🍑💦.json | 13081 | 2024-06-05 10:11:26 |
| - | BIG Happy Easter! 🐰🍑💦[0].png | 2244434 | 2024-06-05 10:11:26 |
| - | BIG Happy Easter! 🐰🍑💦[1].png | 2197244 | 2024-06-05 10:11:26 |
| - | BIG Happy Easter! 🐰🍑💦[2].png | 2200821 | 2024-06-05 10:11:26 |
| - | BIG Hatterene 🫠.json | 13614 | 2024-06-30 11:25:36 |
| - | BIG Hatterene 🫠[0].png | 2122525 | 2024-06-30 11:25:36 |
| - | BIG Hatterene 🫠[1].png | 2111169 | 2024-06-30 11:25:36 |
| - | BIG Hatterene 🫠[2].png | 2076280 | 2024-06-30 11:25:36 |
| - | BIG Isabelle🏝️.json | 12317 | 2024-01-03 11:19:57 |
| - | BIG Isabelle🏝️[0].png | 1866846 | 2024-01-03 11:19:57 |
| - | BIG Isabelle🏝️[1].png | 1843442 | 2024-01-03 11:19:57 |
| - | BIG Isabelle🏝️[2].png | 1849412 | 2024-01-03 11:19:57 |
| - | BIG Krystal 💖.json | 13259 | 2024-06-05 10:12:51 |
| - | BIG Krystal 💖[0].png | 1888258 | 2024-06-05 10:12:51 |
| - | BIG Krystal 💖[1].png | 1902213 | 2024-06-05 10:12:51 |
| - | BIG Krystal 💖[2].png | 1846426 | 2024-06-05 10:12:51 |
| - | BIG Lovander 💗.json | 13956 | 2024-06-05 10:11:51 |
| - | BIG Lovander 💗[0].png | 2149039 | 2024-06-05 10:11:51 |
| - | BIG Lovander 💗[1].png | 2135224 | 2024-06-05 10:11:51 |
| - | BIG Lovander 💗[2].png | 2176868 | 2024-06-05 10:11:52 |
| - | BIG Magic!.json | 10144 | 2023-10-22 10:47:43 |
| - | BIG Magic![0].png | 921994 | 2023-10-22 10:47:43 |
| - | BIG Magic![1].png | 946740 | 2023-10-22 10:47:43 |
| - | BIG Meow Skulls 🍑💦.json | 11412 | 2023-09-06 10:16:01 |
| - | BIG Meow Skulls 🍑💦[0].png | 1877585 | 2023-09-06 10:16:01 |
| - | BIG Meow Skulls 🍑💦[1].png | 1888755 | 2023-09-06 10:16:01 |
| - | BIG Meow Skulls 🍑💦[2].png | 1904233 | 2023-09-06 10:16:01 |
| - | BIG Pearl 🦑🍑💦.json | 18393 | 2024-06-05 10:09:41 |
| - | BIG Pearl 🦑🍑💦[0].png | 1970480 | 2024-06-05 10:09:40 |
| - | BIG Pearl 🦑🍑💦[1].png | 1970541 | 2024-06-05 10:09:40 |
| - | BIG Pearl 🦑🍑💦[2].png | 1969142 | 2024-06-05 10:09:40 |
| - | BIG Pearl 🦑🍑💦[3].png | 1969204 | 2024-06-05 10:09:41 |
| - | BIG Pearl 🦑🍑💦[4].png | 1921678 | 2024-06-05 10:09:41 |
| - | BIG Pearl 🦑🍑💦[5].png | 1921591 | 2024-06-05 10:09:41 |
| - | BIG Slushi 🍑💦.json | 12013 | 2023-10-15 11:32:59 |
| - | BIG Slushi 🍑💦[0].png | 1290505 | 2023-10-15 11:32:59 |
| - | BIG Slushi 🍑💦[1].png | 1269127 | 2023-10-15 11:32:59 |
| - | BIG Slushi 🍑💦[2].png | 1267526 | 2023-10-15 11:33:00 |
| - | BIG Tangle 💛💦 [Part 1].json | 12943 | 2024-01-03 11:19:31 |
| - | BIG Tangle 💛💦 [Part 1][0].png | 962192 | 2024-01-03 11:19:31 |
| - | BIG Tangle 💛💦 [Part 1][1].png | 949637 | 2024-01-03 11:19:31 |
| - | BIG Tangle 💛💦 [Part 1][2].png | 982716 | 2024-01-03 11:19:31 |
| - | BIG Tangle 💛💦 [Part 2].json | 13151 | 2024-01-03 11:19:41 |
| - | BIG Tangle 💛💦 [Part 2][0].png | 1191624 | 2024-01-03 11:19:40 |
| - | BIG Tangle 💛💦 [Part 2][1].png | 1215967 | 2024-01-03 11:19:41 |
| - | BIG Tangle 💛💦 [Part 2][2].png | 1214667 | 2024-01-03 11:19:41 |
| - | BIG Time to de-stress 🫠.json | 7690 | 2024-06-05 10:09:03 |
| - | BIG Time to de-stress 🫠.png | 4417645 | 2024-06-05 10:09:03 |
| - | BIG Toriel Beach Time! 💓🌴🌊.json | 12689 | 2024-01-03 11:19:14 |
| - | BIG Toriel Beach Time! 💓🌴🌊[0].png | 1735316 | 2024-01-03 11:19:14 |
| - | BIG Toriel Beach Time! 💓🌴🌊[1].jpeg | 1195133 | 2024-01-03 11:19:14 |
| - | BIG Toriel Beach Time! 💓🌴🌊[2].png | 1714402 | 2024-01-03 11:19:15 |
| - | BIG Vanilla X Conductor's wife - Valentine's 💞.json | 12815 | 2024-06-05 10:10:34 |
| - | BIG Vanilla X Conductor's wife - Valentine's 💞[0].png | 1567581 | 2024-06-05 10:10:34 |
| - | BIG Vanilla X Conductor's wife - Valentine's 💞[1].png | 1566547 | 2024-06-05 10:10:34 |
| - | BIG Vanilla X Conductor's wife - Valentine's 💞[2].png | 1637620 | 2024-06-05 10:10:35 |
| - | BIG WumpASS Fruit (?) 🍑💦.json | 12230 | 2023-10-15 11:33:25 |
| - | BIG WumpASS Fruit (?) 🍑💦[0].png | 2208063 | 2023-10-15 11:33:25 |
| - | BIG WumpASS Fruit (?) 🍑💦[1].png | 1904995 | 2023-10-15 11:33:25 |
| - | BIG WumpASS Fruit (?) 🍑💦[2].png | 1915342 | 2023-10-15 11:33:25 |
| - | BIG Zhen 🐉💦.json | 12189 | 2024-01-03 11:19:18 |
| - | BIG Zhen 🐉💦[0].png | 2375675 | 2024-01-03 11:19:18 |
| - | BIG Zhen 🐉💦[1].png | 2282513 | 2024-01-03 11:19:18 |
| - | BIG Zhen 🐉💦[2].png | 2403018 | 2024-01-03 11:19:18 |
| - | BIG bunny training 🥕🍑💦.json | 11804 | 2023-10-15 11:33:18 |
| - | BIG bunny training 🥕🍑💦[0].png | 2140588 | 2023-10-15 11:33:17 |
| - | BIG bunny training 🥕🍑💦[1].png | 2149625 | 2023-10-15 11:33:18 |
| - | BIG bunny training 🥕🍑💦[2].png | 2151876 | 2023-10-15 11:33:18 |
| - | BURU NYAASS~ 🍑💦.json | 13815 | 2023-10-15 11:33:06 |
| - | BURU NYAASS~ 🍑💦[0].png | 1261074 | 2023-10-15 11:33:05 |
| - | BURU NYAASS~ 🍑💦[1].png | 1350348 | 2023-10-15 11:33:06 |
| - | BURU NYAASS~ 🍑💦[2].png | 1364068 | 2023-10-15 11:33:06 |
| - | BURU NYAASS~ 🍑💦[3].png | 1327428 | 2023-10-15 11:33:07 |
| - | Bat 🆚 Rabbit.json | 16346 | 2023-01-01 11:09:44 |
| - | Bat 🆚 Rabbit[0].png | 504582 | 2023-01-01 11:09:44 |
| - | Bat 🆚 Rabbit[1].png | 540680 | 2023-01-01 11:09:44 |
| - | Bat 🆚 Rabbit[2].png | 516002 | 2023-01-01 11:09:44 |
| - | Bat 🆚 Rabbit[3].png | 522608 | 2023-01-01 11:09:45 |
| - | Baybay Gardevoir [Comm] 💓.json | 14351 | 2020-01-11 18:51:56 |
| - | Baybay Gardevoir [Comm] 💓[0].png | 630197 | 2020-01-11 18:51:56 |
| - | Baybay Gardevoir [Comm] 💓[1].png | 734362 | 2020-01-11 18:51:56 |
| - | Baybay Gardevoir [Comm] 💓[2].png | 629738 | 2020-01-11 18:51:56 |
| - | Baybay Gardevoir [Comm] 💓[3].png | 729897 | 2020-01-11 18:51:57 |
| - | Be good, alright?.json | 10930 | 2022-02-27 11:56:52 |
| - | Be good, alright?[0].png | 667603 | 2022-02-27 11:56:52 |
| - | Be good, alright?[1].png | 647282 | 2022-02-27 11:56:52 |
| - | Beira (Sketch) [Comm].json | 7794 | 2020-01-11 15:22:32 |
| - | Beira (Sketch) [Comm].png | 242662 | 2020-01-11 15:22:32 |
| - | Beira - Dakimakura [Comm].json | 8416 | 2020-01-12 12:48:44 |
| - | Beira - Dakimakura [Comm].png | 854993 | 2020-01-12 12:48:44 |
| - | Beira Giant [Comm].json | 8078 | 2020-02-16 19:16:33 |
| - | Beira Giant [Comm].png | 1053690 | 2020-02-16 19:16:34 |
| - | Bellassnoir 🍑.json | 9831 | 2024-06-05 10:10:55 |
| - | Bellassnoir 🍑[0].png | 1891153 | 2024-06-05 10:10:55 |
| - | Bellassnoir 🍑[1].png | 1870725 | 2024-06-05 10:10:55 |
| - | Big Amy ❤️💦[Comm].json | 13456 | 2022-06-05 10:57:43 |
| - | Big Amy ❤️💦[Comm][0].png | 737588 | 2022-06-05 10:57:43 |
| - | Big Amy ❤️💦[Comm][1].png | 750714 | 2022-06-05 10:57:43 |
| - | Big Amy ❤️💦[Comm][2].png | 761511 | 2022-06-05 10:57:44 |
| - | Big Cream [Comm].json | 28434 | 2021-10-20 17:13:47 |
| - | Big Cream [Comm][0].png | 540945 | 2021-10-20 17:13:43 |
| - | Big Cream [Comm][10].png | 597526 | 2021-10-20 17:13:47 |
| - | Big Cream [Comm][11].png | 622365 | 2021-10-20 17:13:47 |
| - | Big Cream [Comm][1].png | 546102 | 2021-10-20 17:13:43 |
| - | Big Cream [Comm][2].png | 523813 | 2021-10-20 17:13:44 |
| - | Big Cream [Comm][3].png | 544997 | 2021-10-20 17:13:44 |
| - | Big Cream [Comm][4].png | 551647 | 2021-10-20 17:13:44 |
| - | Big Cream [Comm][5].png | 555699 | 2021-10-20 17:13:45 |
| - | Big Cream [Comm][6].png | 560862 | 2021-10-20 17:13:45 |
| - | Big Cream [Comm][7].png | 585929 | 2021-10-20 17:13:45 |
| - | Big Cream [Comm][8].png | 561196 | 2021-10-20 17:13:46 |
| - | Big Cream [Comm][9].png | 560281 | 2021-10-20 17:13:46 |
| - | Big Crossing - Part 1.json | 13740 | 2022-09-11 10:29:12 |
| - | Big Crossing - Part 1[0].png | 762293 | 2022-09-11 10:29:12 |
| - | Big Crossing - Part 1[1].png | 782665 | 2022-09-11 10:29:12 |
| - | Big Crossing - Part 1[2].png | 713098 | 2022-09-11 10:29:12 |
| - | Big Crossing - Part 1[3].png | 721710 | 2022-09-11 10:29:13 |
| - | Big Crossing - Part 2.json | 13052 | 2022-09-11 10:29:20 |
| - | Big Crossing - Part 2[0].png | 708981 | 2022-09-11 10:29:19 |
| - | Big Crossing - Part 2[1].png | 684026 | 2022-09-11 10:29:19 |
| - | Big Crossing - Part 2[2].png | 689850 | 2022-09-11 10:29:20 |
| - | Big Crossing - Part 2[3].png | 693905 | 2022-09-11 10:29:20 |
| - | Big Dog Princess 👑.json | 12804 | 2023-01-01 11:08:09 |
| - | Big Dog Princess 👑[0].png | 685384 | 2023-01-01 11:08:09 |
| - | Big Dog Princess 👑[1].png | 730554 | 2023-01-01 11:08:09 |
| - | Big Dog Princess 👑[2].png | 748915 | 2023-01-01 11:08:10 |
| - | Big Emoji Alien ❤️.json | 14472 | 2023-01-01 11:08:43 |
| - | Big Emoji Alien ❤️[0].png | 586176 | 2023-01-01 11:08:42 |
| - | Big Emoji Alien ❤️[1].png | 633714 | 2023-01-01 11:08:43 |
| - | Big Emoji Alien ❤️[2].png | 589149 | 2023-01-01 11:08:43 |
| - | Big Emoji Alien ❤️[3].png | 636474 | 2023-01-01 11:08:43 |
| - | Big Fire 🔥(M).json | 9582 | 2023-08-02 10:27:13 |
| - | Big Fire 🔥(M)[0].png | 1450665 | 2023-08-02 10:27:13 |
| - | Big Fire 🔥(M)[1].png | 1454160 | 2023-08-02 10:27:13 |
| - | Big Gadget 🔧❤️💦.json | 14849 | 2022-05-22 10:02:04 |
| - | Big Gadget 🔧❤️💦[0].png | 1125890 | 2022-05-22 10:02:03 |
| - | Big Gadget 🔧❤️💦[1].png | 1122158 | 2022-05-22 10:02:03 |
| - | Big Gadget 🔧❤️💦[2].png | 1044271 | 2022-05-22 10:02:04 |
| - | Big Gadget 🔧❤️💦[3].png | 1048231 | 2022-05-22 10:02:04 |
| - | Big Garnet 💓.json | 12275 | 2024-06-05 10:11:44 |
| - | Big Garnet 💓[0].png | 2016000 | 2024-06-05 10:11:44 |
| - | Big Garnet 💓[1].png | 1999968 | 2024-06-05 10:11:44 |
| - | Big Garnet 💓[2].png | 1971364 | 2024-06-05 10:11:45 |
| - | Big Genius Thumbeh 😉.json | 14538 | 2022-10-12 10:54:21 |
| - | Big Genius Thumbeh 😉[0].png | 579947 | 2022-10-12 10:54:21 |
| - | Big Genius Thumbeh 😉[1].png | 561348 | 2022-10-12 10:54:21 |
| - | Big Genius Thumbeh 😉[2].png | 539195 | 2022-10-12 10:54:21 |
| - | Big Genius Thumbeh 😉[3].png | 520469 | 2022-10-12 10:54:21 |
| - | Big GrandCouncilwoman.json | 13508 | 2023-01-01 11:08:02 |
| - | Big GrandCouncilwoman[0].png | 940068 | 2023-01-01 11:08:02 |
| - | Big GrandCouncilwoman[1].png | 998987 | 2023-01-01 11:08:02 |
| - | Big GrandCouncilwoman[2].png | 1005516 | 2023-01-01 11:08:03 |
| - | Big Gwen.gif | 2930216 | 2023-04-02 11:10:28 |
| - | Big Gwen.json | 7096 | 2023-04-02 11:10:28 |
| - | Big Hariet 🐰🌟.json | 13101 | 2024-06-05 10:11:28 |
| - | Big Hariet 🐰🌟[0].png | 2523197 | 2024-06-05 10:11:28 |
| - | Big Hariet 🐰🌟[1].png | 2371756 | 2024-06-05 10:11:28 |
| - | Big Hariet 🐰🌟[2].png | 2377013 | 2024-06-05 10:11:28 |
| - | Big Jade.json | 12624 | 2024-06-05 10:12:48 |
| - | Big Jade[0].png | 2140770 | 2024-06-05 10:12:48 |
| - | Big Jade[1].png | 2122380 | 2024-06-05 10:12:48 |
| - | Big Jade[2].png | 2123401 | 2024-06-05 10:12:48 |
| - | Big Jasmine (OC) 🍑.json | 10535 | 2023-08-20 11:15:18 |
| - | Big Jasmine (OC) 🍑[0].png | 1372177 | 2023-08-20 11:15:17 |
| - | Big Jasmine (OC) 🍑[1].png | 1379705 | 2023-08-20 11:15:18 |
| - | Big Jasmine (OC) 🍑[2].png | 1425416 | 2023-08-20 11:15:18 |
| - | Big Lavendula.json | 12829 | 2024-06-05 10:12:57 |
| - | Big Lavendula[0].png | 459604 | 2024-06-05 10:12:57 |
| - | Big Lavendula[1].png | 415163 | 2024-06-05 10:12:57 |
| - | Big Lavendula[2].png | 432958 | 2024-06-05 10:12:58 |
| - | Big Loona [Comm].json | 12074 | 2022-06-08 10:47:15 |
| - | Big Loona [Comm][0].png | 785999 | 2022-06-08 10:47:15 |
| - | Big Loona [Comm][1].png | 866271 | 2022-06-08 10:47:15 |
| - | Big Loona [Comm][2].png | 808355 | 2022-06-08 10:47:16 |
| - | Big Maggie Pesky [Comm].json | 11148 | 2022-05-04 10:11:25 |
| - | Big Maggie Pesky [Comm][0].png | 659735 | 2022-05-04 10:11:25 |
| - | Big Maggie Pesky [Comm][1].png | 734486 | 2022-05-04 10:11:25 |
| - | Big Mama Togekiss 💙.json | 6613 | 2023-08-20 11:14:58 |
| - | Big Mama Togekiss 💙.png | 832187 | 2023-08-20 11:14:59 |
| - | Big Mushrooms 🍄💦 [Comm].json | 14776 | 2022-06-08 10:48:48 |
| - | Big Mushrooms 🍄💦 [Comm][0].png | 969041 | 2022-06-08 10:48:47 |
| - | Big Mushrooms 🍄💦 [Comm][1].png | 1017172 | 2022-06-08 10:48:47 |
| - | Big Mushrooms 🍄💦 [Comm][2].png | 1020634 | 2022-06-08 10:48:48 |
| - | Big Mushrooms 🍄💦 [Comm][3].png | 1034510 | 2022-06-08 10:48:48 |
| - | Big Nina [Comm].json | 10621 | 2021-11-08 21:00:58 |
| - | Big Nina [Comm][0].png | 951684 | 2021-11-08 21:00:58 |
| - | Big Nina [Comm][1].png | 1171935 | 2021-11-08 21:00:59 |
| - | Big Sally.json | 13718 | 2022-09-11 10:29:56 |
| - | Big Sally[0].png | 605280 | 2022-09-11 10:29:56 |
| - | Big Sally[1].png | 488597 | 2022-09-11 10:29:56 |
| - | Big Sally[2].png | 555736 | 2022-09-11 10:29:56 |
| - | Big Spirit Balloon.json | 9772 | 2024-06-09 10:29:58 |
| - | Big Spirit Balloon[0].png | 1762665 | 2024-06-09 10:29:58 |
| - | Big Spirit Balloon[1].png | 1781925 | 2024-06-09 10:29:59 |
| - | Big Surprise.json | 15603 | 2022-09-11 10:29:01 |
| - | Big Surprise[0].png | 2081883 | 2022-09-11 10:29:01 |
| - | Big Surprise[1].png | 2048833 | 2022-09-11 10:29:01 |
| - | Big Surprise[2].png | 1967325 | 2022-09-11 10:29:01 |
| - | Big Surprise[3].png | 2287369 | 2022-09-11 10:29:02 |
| - | Big Tsukino.json | 19230 | 2023-04-02 11:09:38 |
| - | Big Tsukino[0].png | 755080 | 2023-04-02 11:09:35 |
| - | Big Tsukino[1].png | 751256 | 2023-04-02 11:09:35 |
| - | Big Tsukino[2].png | 788505 | 2023-04-02 11:09:37 |
| - | Big Tsukino[3].png | 1110788 | 2023-04-02 11:09:38 |
| - | Big Tsukino[4].png | 774419 | 2023-04-02 11:09:38 |
| - | Big Tsukino[5].png | 812135 | 2023-04-02 11:09:38 |
| - | Big Tsukino[6].png | 816404 | 2023-04-02 11:09:39 |
| - | Big Vanny 🔦💦.json | 14125 | 2022-07-17 10:26:37 |
| - | Big Vanny 🔦💦[0].png | 1115880 | 2022-07-17 10:26:37 |
| - | Big Vanny 🔦💦[1].png | 1198796 | 2022-07-17 10:26:37 |
| - | Big Vanny 🔦💦[2].png | 894701 | 2022-07-17 10:26:37 |
| - | Big Vanny 🔦💦[3].png | 1071344 | 2022-07-17 10:26:37 |
| - | Big Vex.json | 19496 | 2021-12-07 19:41:45 |
| - | Big Vex[0].png | 739307 | 2021-12-07 19:41:44 |
| - | Big Vex[1].png | 803078 | 2021-12-07 19:41:45 |
| - | Big Vex[2].png | 924520 | 2021-12-07 19:41:45 |
| - | Big Vex[3].png | 894252 | 2021-12-07 19:41:45 |
| - | Big Vex[4].png | 903527 | 2021-12-07 19:41:45 |
| - | Big Vex[5].png | 949261 | 2021-12-07 19:41:45 |
| - | Big Vex[6].png | 956446 | 2021-12-07 19:41:46 |
| - | Big Yaya [Comm].json | 7993 | 2022-02-27 11:56:43 |
| - | Big Yaya [Comm].png | 586786 | 2022-02-27 11:56:43 |
| - | Big cute Loona 🐺💦.json | 12583 | 2023-01-01 11:06:51 |
| - | Big cute Loona 🐺💦[0].png | 485350 | 2023-01-01 11:06:51 |
| - | Big cute Loona 🐺💦[1].png | 495704 | 2023-01-01 11:06:51 |
| - | Big cute Loona 🐺💦[2].png | 478599 | 2023-01-01 11:06:52 |
| - | Big technique.json | 17872 | 2021-10-25 01:26:35 |
| - | Big technique[0].png | 1305799 | 2021-10-25 01:26:32 |
| - | Big technique[1].png | 1376841 | 2021-10-25 01:26:33 |
| - | Big technique[2].png | 1427167 | 2021-10-25 01:26:34 |
| - | Big technique[3].png | 1331042 | 2021-10-25 01:26:35 |
| - | Big technique[4].png | 1407821 | 2021-10-25 01:26:36 |
| - | Biggest Fan! 🌭💦.json | 14098 | 2023-01-01 11:09:18 |
| - | Biggest Fan! 🌭💦[0].png | 969843 | 2023-01-01 11:09:18 |
| - | Biggest Fan! 🌭💦[1].png | 987909 | 2023-01-01 11:09:18 |
| - | Biggest Fan! 🌭💦[2].png | 995416 | 2023-01-01 11:09:19 |
| - | Bimbo Worshippin' [Comm].json | 14813 | 2021-10-18 19:18:23 |
| - | Bimbo Worshippin' [Comm][0].png | 638481 | 2021-10-18 19:18:22 |
| - | Bimbo Worshippin' [Comm][1].png | 712281 | 2021-10-18 19:18:22 |
| - | Bimbo Worshippin' [Comm][2].png | 683950 | 2021-10-18 19:18:23 |
| - | Bimbo Worshippin' [Comm][3].png | 756282 | 2021-10-18 19:18:23 |
| - | BlASSiken 🐥🔥.json | 12699 | 2024-06-09 10:57:22 |
| - | BlASSiken 🐥🔥[0].png | 2185075 | 2024-06-09 10:57:22 |
| - | BlASSiken 🐥🔥[1].png | 2136206 | 2024-06-09 10:57:22 |
| - | BlASSiken 🐥🔥[2].png | 2149008 | 2024-06-09 10:57:23 |
| - | Blaze X Rouge - Slut Mania Plus.json | 11913 | 2020-01-17 14:14:30 |
| - | Blaze X Rouge - Slut Mania Plus[0].png | 1180634 | 2020-01-17 14:14:30 |
| - | Blaze X Rouge - Slut Mania Plus[1].png | 782895 | 2020-01-17 14:14:30 |
| - | Blaze X Rouge [Patreon Comm].json | 11077 | 2018-11-24 14:06:37 |
| - | Blaze X Rouge [Patreon Comm][0].png | 868799 | 2018-11-24 14:06:37 |
| - | Blaze X Rouge [Patreon Comm][1].png | 872141 | 2018-11-24 14:06:37 |
| - | Blaze the BIG Cat 🍑💦.json | 12228 | 2024-01-03 11:19:10 |
| - | Blaze the BIG Cat 🍑💦[0].png | 1880871 | 2024-01-03 11:19:10 |
| - | Blaze the BIG Cat 🍑💦[1].png | 2006790 | 2024-01-03 11:19:10 |
| - | Blaze the BIG Cat 🍑💦[2].png | 2032718 | 2024-01-03 11:19:10 |
| - | Blaze the Cat 2.json | 6730 | 2018-11-19 06:28:22 |
| - | Blaze the Cat.json | 5549 | 2018-11-19 00:33:41 |
| - | Blaze's Vela Nova [Comm].json | 18131 | 2020-10-15 07:08:05 |
| - | Blaze's Vela Nova [Comm][0].png | 687667 | 2020-10-15 07:07:57 |
| - | Blaze's Vela Nova [Comm][1].png | 690766 | 2020-10-15 07:07:58 |
| - | Blaze's Vela Nova [Comm][2].png | 690430 | 2020-10-15 07:08:00 |
| - | Blaze's Vela Nova [Comm][3].png | 707059 | 2020-10-15 07:08:03 |
| - | Blaze's Vela Nova [Comm][4].png | 710009 | 2020-10-15 07:08:05 |
| - | Blaze's Vela Nova [Comm][5].png | 709683 | 2020-10-15 07:08:06 |
| - | Blaziken - Commission.json | 8267 | 2018-11-19 13:23:37 |
| - | Blaziken 2 - Commission.json | 5175 | 2018-11-19 15:17:01 |
| - | Blaziken X Peent - Commission.json | 10498 | 2018-11-19 13:28:43 |
| - | Blaziken [Comm].json | 10805 | 2020-05-14 01:46:53 |
| - | Blaziken [Comm][0].png | 945145 | 2020-05-14 01:46:53 |
| - | Blaziken [Comm][1].png | 945428 | 2020-05-14 01:46:53 |
| - | Blaziken on fire [Comm].json | 14410 | 2020-09-29 01:33:02 |
| - | Blaziken on fire [Comm][0].png | 532756 | 2020-09-29 01:32:59 |
| - | Blaziken on fire [Comm][1].png | 587284 | 2020-09-29 01:33:01 |
| - | Blaziken on fire [Comm][2].png | 750856 | 2020-09-29 01:33:02 |
| - | Blaziken on fire [Comm][3].png | 754230 | 2020-09-29 01:33:04 |
| - | Blaziken.json | 5018 | 2018-11-18 22:37:38 |
| - | Blue - Commission.json | 7230 | 2018-11-23 11:30:32 |
| - | Blue - Commission.png | 736020 | 2018-11-23 11:30:32 |
| - | Blue Bunnies Doing What They Do Best.json | 19528 | 2021-11-27 22:41:45 |
| - | Blue Bunnies Doing What They Do Best[0].png | 1314798 | 2021-11-27 22:41:45 |
| - | Blue Bunnies Doing What They Do Best[1].png | 1134893 | 2021-11-27 22:41:45 |
| - | Blue Bunnies Doing What They Do Best[2].png | 1257558 | 2021-11-27 22:41:45 |
| - | Blue Bunnies Doing What They Do Best[3].png | 1259723 | 2021-11-27 22:41:45 |
| - | Blue Bunnies Doing What They Do Best[4].png | 1265118 | 2021-11-27 22:41:45 |
| - | Blue Bunnies Doing What They Do Best[5].png | 1224784 | 2021-11-27 22:41:46 |
| - | Bobbi Mae Hampton - Commission.json | 7338 | 2018-11-23 10:20:11 |
| - | Bobbi Mae Hampton - Commission.png | 490414 | 2018-11-23 10:20:12 |
| - | Bountiful Bust.json | 11346 | 2022-10-12 10:54:12 |
| - | Bountiful Bust[0].png | 497996 | 2022-10-12 10:54:12 |
| - | Bountiful Bust[1].png | 534618 | 2022-10-12 10:54:12 |
| - | Brianna Lynn - Commission.json | 11080 | 2018-11-22 12:27:36 |
| - | Bruna - Commission.json | 5604 | 2018-11-19 13:17:42 |
| - | Buffalo Bell .json | 5464 | 2018-11-18 21:41:46 |
| - | Bunnie D'Coolette [Patreon Comm].json | 8238 | 2019-02-01 05:02:08 |
| - | Bunnie D'Coolette [Patreon Comm].png | 1333290 | 2019-02-01 05:02:08 |
| - | Busty Galaxy Fighter Roomi 🌟.json | 19767 | 2023-04-02 11:09:52 |
| - | Busty Galaxy Fighter Roomi 🌟[0].png | 462529 | 2023-04-02 11:09:50 |
| - | Busty Galaxy Fighter Roomi 🌟[1].png | 447127 | 2023-04-02 11:09:50 |
| - | Busty Galaxy Fighter Roomi 🌟[2].png | 478169 | 2023-04-02 11:09:51 |
| - | Busty Galaxy Fighter Roomi 🌟[3].png | 490248 | 2023-04-02 11:09:51 |
| - | Busty Galaxy Fighter Roomi 🌟[4].png | 490130 | 2023-04-02 11:09:51 |
| - | Busty Galaxy Fighter Roomi 🌟[5].png | 469118 | 2023-04-02 11:09:52 |
| - | Busty Galaxy Fighter Roomi 🌟[6].png | 479676 | 2023-04-02 11:09:52 |
| - | Busty Galaxy Fighter Roomi 🌟[7].png | 466257 | 2023-04-02 11:09:52 |
| - | COMMISSION - ROUND 4 [2017] [OPEN].json | 23132 | 2018-11-22 03:39:46 |
| - | COMMISSION - ROUND 5 [2017] [OPEN].json | 13294 | 2018-11-22 09:05:48 |
| - | COMMISSION - ROUND 6 [2017] [OPEN].json | 13337 | 2018-11-22 11:10:12 |
| - | COMMISSIONS [2018] - ROUND 1.json | 25536 | 2018-11-23 02:54:41 |
| - | COMMISSIONS [2018] - ROUND 2.json | 26555 | 2018-11-23 09:06:48 |
| - | COMMISSIONS [2018] - ROUND 2[0].png | 1900875 | 2018-11-23 09:06:47 |
| - | COMMISSIONS [2018] - ROUND 2[1].png | 4597175 | 2018-11-23 09:06:47 |
| - | COMMISSIONS [2018] - ROUND 2[5].png | 7417632 | 2018-11-23 09:06:48 |
| - | COMMISSIONS [2018] - ROUND 2[6].png | 543528 | 2018-11-23 09:06:48 |
| - | COMMISSIONS [2018] - ROUND 3 (OPEN).json | 20722 | 2018-11-24 09:53:56 |
| - | COMMISSIONS [2018] - ROUND 3 (OPEN)[0].png | 15117239 | 2018-11-24 09:53:55 |
| - | COMMISSIONS [2018] - ROUND 3 (OPEN)[1].png | 4831895 | 2018-11-24 09:53:55 |
| - | COMMISSIONS [2018] - ROUND 3 (OPEN)[2].png | 5407745 | 2018-11-24 09:53:56 |
| - | COMMISSIONS [2018] - ROUND 3 (OPEN)[3].png | 4673263 | 2018-11-24 09:53:56 |
| - | COMMISSIONS [2019] (OPEN).json | 20329 | 2020-01-11 15:05:12 |
| - | COMMISSIONS [2019] (OPEN)[0].png | 1588843 | 2020-01-11 15:05:11 |
| - | COMMISSIONS [2019] (OPEN)[1].png | 5383457 | 2020-01-11 15:05:12 |
| - | COMMISSIONS [2019] (OPEN)[2].png | 1626284 | 2020-01-11 15:05:12 |
| - | COMMISSIONS [2019] (OPEN)[3].png | 936233 | 2020-01-11 15:05:12 |
| - | COMMISSIONS [2021] (OPEN).json | 22065 | 2021-10-25 16:21:08 |
| - | COMMISSIONS [2021] (OPEN)[0].png | 5290326 | 2021-10-25 16:21:06 |
| - | COMMISSIONS [2021] (OPEN)[1].png | 2199766 | 2021-10-25 16:21:07 |
| - | COMMISSIONS [2021] (OPEN)[2].png | 641856 | 2021-10-25 16:21:07 |
| - | COMMISSIONS [2021] (OPEN)[3].png | 710264 | 2021-10-25 16:21:08 |
| - | COMMISSIONS [2021] (OPEN)[4].png | 1583362 | 2021-10-25 16:21:08 |
| - | COMMISSIONS [2022] (OPEN).json | 19479 | 2022-09-11 10:31:04 |
| - | COMMISSIONS [2022] (OPEN)[0].png | 789570 | 2022-09-11 10:31:04 |
| - | COMMISSIONS [2022] (OPEN)[1].png | 1963510 | 2022-09-11 10:31:04 |
| - | COMMISSIONS [2022] (OPEN)[2].png | 493353 | 2022-09-11 10:31:04 |
| - | COMMISSIONS [2022] (OPEN)[3].png | 725370 | 2022-09-11 10:31:05 |
| - | Cabal - OC.json | 13026 | 2020-09-27 16:24:15 |
| - | Cabal - OC[0].png | 926066 | 2020-09-27 16:24:12 |
| - | Cabal - OC[1].png | 962577 | 2020-09-27 16:24:15 |
| - | Cabal - OC[2].png | 965098 | 2020-09-27 16:24:17 |
| - | Cain [Comm].json | 11987 | 2021-04-13 05:08:11 |
| - | Cain [Comm][0].png | 648923 | 2021-04-13 05:08:10 |
| - | Cain [Comm][1].png | 657497 | 2021-04-13 05:08:11 |
| - | Cain [Comm][2].png | 658518 | 2021-04-13 05:08:12 |
| - | Calypso the Primarina [Comm].json | 11816 | 2019-04-12 00:53:30 |
| - | Calypso the Primarina [Comm][0].png | 824912 | 2019-04-12 00:53:30 |
| - | Calypso the Primarina [Comm][1].png | 840207 | 2019-04-12 00:53:30 |
| - | Candy Kong - Commission.json | 6500 | 2018-11-21 20:25:05 |
| - | Candy Kong X Horse - Commission.json | 11950 | 2018-11-22 04:29:01 |
| - | Canutté Berri - Commission.json | 12171 | 2018-11-23 06:35:16 |
| - | Captain Amelia - Commission.json | 6711 | 2018-11-22 07:23:44 |
| - | Captain Celaeno [Patreon Comm].json | 11505 | 2018-11-24 14:55:05 |
| - | Captain Celaeno [Patreon Comm][0].png | 801548 | 2018-11-24 14:55:05 |
| - | Captain Celaeno [Patreon Comm][1].png | 820157 | 2018-11-24 14:55:05 |
| - | Carol and Lilac - Commission.json | 8833 | 2018-11-19 13:31:52 |
| - | Catherine - Worgen stretching [Comm].json | 13312 | 2022-02-27 11:57:22 |
| - | Catherine - Worgen stretching [Comm][0].png | 807281 | 2022-02-27 11:57:20 |
| - | Catherine - Worgen stretching [Comm][1].png | 852251 | 2022-02-27 11:57:22 |
| - | Catherine - Worgen stretching [Comm][2].png | 867971 | 2022-02-27 11:57:22 |
| - | Celeste Presenting [Comm].json | 10649 | 2021-11-08 21:00:46 |
| - | Celeste Presenting [Comm][0].png | 896898 | 2021-11-08 21:00:46 |
| - | Celeste Presenting [Comm][1].png | 1034505 | 2021-11-08 21:00:47 |
| - | Chao _ Flora X Bass [Comm].json | 21350 | 2021-04-03 17:36:31 |
| - | Chao _ Flora X Bass [Comm][0].png | 466488 | 2021-04-03 17:36:15 |
| - | Chao _ Flora X Bass [Comm][1].png | 474311 | 2021-04-03 17:36:18 |
| - | Chao _ Flora X Bass [Comm][2].png | 487229 | 2021-04-03 17:36:21 |
| - | Chao _ Flora X Bass [Comm][3].png | 494621 | 2021-04-03 17:36:24 |
| - | Chao _ Flora X Bass [Comm][4].png | 675575 | 2021-04-03 17:36:27 |
| - | Chao _ Flora X Bass [Comm][5].png | 680828 | 2021-04-03 17:36:29 |
| - | Chao _ Flora X Bass [Comm][6].png | 698515 | 2021-04-03 17:36:31 |
| - | Chao _ Flora X Bass [Comm][7].png | 703398 | 2021-04-03 17:36:42 |
| - | Charlotte Butler - OC [Comm].json | 10291 | 2020-05-13 01:41:34 |
| - | Charlotte Butler - OC [Comm][0].png | 1211453 | 2020-05-13 01:41:34 |
| - | Charlotte Butler - OC [Comm][1].png | 1080963 | 2020-05-13 01:41:34 |
| - | Charlotte [Comm].json | 15121 | 2021-04-13 04:35:37 |
| - | Charlotte [Comm][0].png | 576910 | 2021-04-13 04:35:34 |
| - | Charlotte [Comm][1].png | 648452 | 2021-04-13 04:35:36 |
| - | Charlotte [Comm][2].png | 647001 | 2021-04-13 04:35:37 |
| - | Charlotte [Comm][3].png | 656202 | 2021-04-13 04:35:38 |
| - | Chatalie - Commission.json | 10215 | 2018-11-22 08:38:16 |
| - | Cheerleader of Victory ✌️.json | 13027 | 2022-10-12 10:55:17 |
| - | Cheerleader of Victory ✌️[0].png | 580466 | 2022-10-12 10:55:17 |
| - | Cheerleader of Victory ✌️[1].png | 564097 | 2022-10-12 10:55:17 |
| - | Cheerleader of Victory ✌️[2].png | 493813 | 2022-10-12 10:55:17 |
| - | Cherri Bomb [Comm].json | 11064 | 2021-03-08 21:33:12 |
| - | Cherri Bomb [Comm][0].png | 689221 | 2021-03-08 21:33:12 |
| - | Cherri Bomb [Comm][1].png | 680222 | 2021-03-08 21:33:13 |
| - | Chibi - Fyra T Rose [Comm].json | 6962 | 2018-11-24 11:48:00 |
| - | Chibi - Fyra T Rose [Comm].png | 302713 | 2018-11-24 11:48:01 |
| - | Chihara [Patreon Comm].json | 11213 | 2020-01-12 04:48:23 |
| - | Chihara [Patreon Comm][0].png | 746653 | 2020-01-12 04:48:23 |
| - | Chihara [Patreon Comm][1].png | 758374 | 2020-01-12 04:48:24 |
| - | Chrysalis Time [Patreon Comm].json | 11156 | 2020-05-13 02:39:06 |
| - | Chrysalis Time [Patreon Comm][0].png | 997334 | 2020-05-13 02:39:06 |
| - | Chrysalis Time [Patreon Comm][1].png | 1007522 | 2020-05-13 02:39:07 |
| - | Chuzina - Commission.json | 5206 | 2018-11-19 13:23:36 |
| - | Cinderace [Comm].json | 14231 | 2020-09-26 19:01:23 |
| - | Cinderace [Comm][0].png | 911219 | 2020-09-26 19:01:20 |
| - | Cinderace [Comm][1].png | 1007493 | 2020-09-26 19:01:22 |
| - | Cinderace [Comm][2].png | 923044 | 2020-09-26 19:01:23 |
| - | Cinderace [Comm][3].png | 1020832 | 2020-09-26 19:01:24 |
| - | Cirli the Imp 🍩 [Comm].json | 7375 | 2020-05-13 01:55:55 |
| - | Cirli the Imp 🍩 [Comm].png | 741855 | 2020-05-13 01:55:56 |
| - | Classy Sally [Comm].json | 16783 | 2021-11-08 21:01:13 |
| - | Classy Sally [Comm][0].png | 593290 | 2021-11-08 21:01:12 |
| - | Classy Sally [Comm][1].png | 592340 | 2021-11-08 21:01:12 |
| - | Classy Sally [Comm][2].png | 601585 | 2021-11-08 21:01:12 |
| - | Classy Sally [Comm][3].png | 591204 | 2021-11-08 21:01:13 |
| - | Classy Sally [Comm][4].png | 624455 | 2021-11-08 21:01:13 |
| - | Classy Sally [Comm][5].png | 659965 | 2021-11-08 21:01:13 |
| - | Clawroline - Un-Forgotten Land.json | 12434 | 2022-02-27 11:57:49 |
| - | Clawroline - Un-Forgotten Land[0].png | 1065726 | 2022-02-27 11:57:49 |
| - | Clawroline - Un-Forgotten Land[1].png | 1066833 | 2022-02-27 11:57:49 |
| - | Clawroline - Un-Forgotten Land[2].png | 1115274 | 2022-02-27 11:57:50 |
| - | Clumsy Sunny [Comm].json | 10694 | 2021-10-20 16:46:48 |
| - | Clumsy Sunny [Comm][0].png | 610490 | 2021-10-20 16:46:48 |
| - | Clumsy Sunny [Comm][1].png | 599988 | 2021-10-20 16:46:49 |
| - | Coco - Bust Style [Comm].json | 16304 | 2020-09-29 20:48:57 |
| - | Coco - Bust Style [Comm][0].png | 519917 | 2020-09-29 20:48:48 |
| - | Coco - Bust Style [Comm][1].png | 515309 | 2020-09-29 20:48:51 |
| - | Coco - Bust Style [Comm][2].png | 530145 | 2020-09-29 20:48:54 |
| - | Coco - Bust Style [Comm][3].png | 464594 | 2020-09-29 20:48:57 |
| - | Coco - Bust Style [Comm][4].png | 550153 | 2020-09-29 20:48:59 |
| - | Coco Bandicoot - Commission .json | 5016 | 2018-11-19 13:16:25 |
| - | Coco Bandicoot - Commission B.json | 10746 | 2018-11-21 11:54:00 |
| - | Coco Bandicoot 🥥🥥👀💦.json | 14363 | 2020-01-11 17:05:06 |
| - | Coco Bandicoot 🥥🥥👀💦[0].png | 1111599 | 2020-01-11 17:05:05 |
| - | Coco Bandicoot 🥥🥥👀💦[1].png | 883661 | 2020-01-11 17:05:06 |
| - | Coco Bandicoot 🥥🥥👀💦[2].png | 1107408 | 2020-01-11 17:05:06 |
| - | Coco Bandicoot 🥥🥥👀💦[3].png | 887907 | 2020-01-11 17:05:06 |
| - | Coco Butticoot 🍑✨.json | 11141 | 2023-01-01 12:11:12 |
| - | Coco Butticoot 🍑✨[0].gif | 18010477 | 2023-01-01 12:11:12 |
| - | Coco Butticoot 🍑✨[1].gif | 18191650 | 2023-01-01 12:11:13 |
| - | Coco X Coal [Comm].json | 22073 | 2021-10-20 16:19:45 |
| - | Coco X Coal [Comm][0].png | 1020253 | 2021-10-20 16:19:42 |
| - | Coco X Coal [Comm][1].png | 1033914 | 2021-10-20 16:19:42 |
| - | Coco X Coal [Comm][2].png | 923825 | 2021-10-20 16:19:43 |
| - | Coco X Coal [Comm][3].png | 936096 | 2021-10-20 16:19:43 |
| - | Coco X Coal [Comm][4].png | 855131 | 2021-10-20 16:19:44 |
| - | Coco X Coal [Comm][5].png | 947200 | 2021-10-20 16:19:44 |
| - | Coco X Coal [Comm][6].png | 921816 | 2021-10-20 16:19:45 |
| - | Coco X Coal [Comm][7].png | 935112 | 2021-10-20 16:19:46 |
| - | Coco's Cute.json | 21607 | 2022-03-27 10:11:23 |
| - | Coco's Cute[0].png | 601798 | 2022-03-27 10:11:18 |
| - | Coco's Cute[1].png | 613401 | 2022-03-27 10:11:19 |
| - | Coco's Cute[2].png | 544679 | 2022-03-27 10:11:20 |
| - | Coco's Cute[3].png | 553005 | 2022-03-27 10:11:21 |
| - | Coco's Cute[4].png | 592521 | 2022-03-27 10:11:21 |
| - | Coco's Cute[5].png | 552064 | 2022-03-27 10:11:22 |
| - | Coco's Cute[6].png | 574531 | 2022-03-27 10:11:23 |
| - | Coco's Cute[7].png | 574078 | 2022-03-27 10:11:23 |
| - | Comet [Patreon Comm].json | 10378 | 2019-03-06 01:33:30 |
| - | Comet [Patreon Comm][0].png | 684468 | 2019-03-06 01:33:30 |
| - | Comet [Patreon Comm][1].png | 697393 | 2019-03-06 01:33:30 |
| - | Commission Info and Prices [2023].json | 12440 | 2023-08-06 11:36:01 |
| - | Commission Info and Prices [2023].png | 2209239 | 2023-08-06 11:36:01 |
| - | Cozmo - Too hot in here [Comm].json | 12454 | 2021-02-17 02:27:32 |
| - | Cozmo - Too hot in here [Comm][0].png | 730345 | 2021-02-17 02:27:18 |
| - | Cozmo - Too hot in here [Comm][1].png | 743677 | 2021-02-17 02:27:32 |
| - | Cozmo - Too hot in here [Comm][2].png | 662408 | 2021-02-17 02:27:36 |
| - | Cream Filled Mongoose [Patreon Comm].json | 11828 | 2020-01-12 14:49:52 |
| - | Cream Filled Mongoose [Patreon Comm][0].png | 735318 | 2020-01-12 14:49:52 |
| - | Cream Filled Mongoose [Patreon Comm][1].png | 811152 | 2020-01-12 14:49:52 |
| - | Cream and Friends [Sketch].json | 18435 | 2020-09-30 06:39:35 |
| - | Cream and Friends [Sketch][0].png | 311931 | 2020-09-30 06:39:27 |
| - | Cream and Friends [Sketch][1].png | 312697 | 2020-09-30 06:39:29 |
| - | Cream and Friends [Sketch][2].png | 315187 | 2020-09-30 06:39:31 |
| - | Cream and Friends [Sketch][3].png | 318033 | 2020-09-30 06:39:33 |
| - | Cream and Friends [Sketch][4].png | 317098 | 2020-09-30 06:39:35 |
| - | Cream and Friends [Sketch][5].png | 323657 | 2020-09-30 06:39:36 |
| - | Cream with Cream [Comm].json | 14725 | 2020-04-13 01:56:06 |
| - | Cream with Cream [Comm][0].png | 952851 | 2020-04-13 01:56:00 |
| - | Cream with Cream [Comm][1].png | 956367 | 2020-04-13 01:56:02 |
| - | Cream with Cream [Comm][2].png | 969131 | 2020-04-13 01:56:05 |
| - | Cream with Cream [Comm][3].png | 972377 | 2020-04-13 01:56:06 |
| - | Cream-White Fox Mom [Comm].json | 14373 | 2021-11-08 21:01:05 |
| - | Cream-White Fox Mom [Comm][0].png | 669418 | 2021-11-08 21:01:05 |
| - | Cream-White Fox Mom [Comm][1].png | 664543 | 2021-11-08 21:01:05 |
| - | Cream-White Fox Mom [Comm][2].png | 654242 | 2021-11-08 21:01:05 |
| - | Cream-White Fox Mom [Comm][3].png | 589921 | 2021-11-08 21:01:06 |
| - | Crissy - Gank Tanks.json | 11990 | 2023-01-01 11:07:48 |
| - | Crissy - Gank Tanks[0].png | 283419 | 2023-01-01 11:07:48 |
| - | Crissy - Gank Tanks[1].png | 322997 | 2023-01-01 11:07:48 |
| - | Crissy - Gank Tanks[2].png | 295068 | 2023-01-01 11:07:49 |
| - | Croissant X Rutmutt - Commission.json | 9997 | 2018-11-22 19:03:54 |
| - | Cuddle Team Leader - Bust Style [Comm].json | 15324 | 2020-02-17 02:39:27 |
| - | Cuddle Team Leader - Bust Style [Comm][0].png | 622094 | 2020-02-17 02:39:26 |
| - | Cuddle Team Leader - Bust Style [Comm][1].png | 628461 | 2020-02-17 02:39:26 |
| - | Cuddle Team Leader - Bust Style [Comm][2].png | 449932 | 2020-02-17 02:39:27 |
| - | Cuddle Team Leader - Bust Style [Comm][3].png | 454547 | 2020-02-17 02:39:28 |
| - | Cute Fire 🔥(F).json | 9210 | 2023-08-02 10:27:10 |
| - | Cute Fire 🔥(F)[0].png | 829980 | 2023-08-02 10:27:10 |
| - | Cute Fire 🔥(F)[1].png | 1444444 | 2023-08-02 10:27:10 |
| - | Cute Froppy.json | 11950 | 2022-02-27 11:57:39 |
| - | Cute Froppy[0].png | 785278 | 2022-02-27 11:57:39 |
| - | Cute Froppy[1].png | 682402 | 2022-02-27 11:57:39 |
| - | Cute Reindeer Sighting.json | 10666 | 2022-10-12 10:55:13 |
| - | Cute Reindeer Sighting[0].png | 578768 | 2022-10-12 10:55:13 |
| - | Cute Reindeer Sighting[1].png | 409965 | 2022-10-12 10:55:13 |
| - | Deep CutE 🐙🦑🎶.json | 12931 | 2022-09-11 10:29:39 |
| - | Deep CutE 🐙🦑🎶[0].png | 766450 | 2022-09-11 10:29:38 |
| - | Deep CutE 🐙🦑🎶[1].png | 759197 | 2022-09-11 10:29:39 |
| - | Deep CutE 🐙🦑🎶[2].png | 648717 | 2022-09-11 10:29:39 |
| - | Delphox - Bust Style [Patreon Comm].json | 25867 | 2020-09-26 05:16:41 |
| - | Delphox - Bust Style [Patreon Comm][0].png | 796316 | 2020-09-26 05:16:31 |
| - | Delphox - Bust Style [Patreon Comm][1].png | 749795 | 2020-09-26 05:16:32 |
| - | Delphox - Bust Style [Patreon Comm][2].png | 798291 | 2020-09-26 05:16:34 |
| - | Delphox - Bust Style [Patreon Comm][3].png | 816883 | 2020-09-26 05:16:35 |
| - | Delphox - Bust Style [Patreon Comm][4].png | 803616 | 2020-09-26 05:16:37 |
| - | Delphox - Bust Style [Patreon Comm][5].png | 829986 | 2020-09-26 05:16:38 |
| - | Delphox - Bust Style [Patreon Comm][6].png | 829128 | 2020-09-26 05:16:39 |
| - | Delphox - Bust Style [Patreon Comm][7].png | 855369 | 2020-09-26 05:16:40 |
| - | Delphox - Bust Style [Patreon Comm][8].png | 841446 | 2020-09-26 05:16:41 |
| - | Delphox - Bust Style [Patreon Comm][9].png | 867922 | 2020-09-26 05:16:43 |
| - | Delphox - Commission.json | 13867 | 2018-11-22 22:57:28 |
| - | Demona - Commission.json | 6385 | 2018-11-21 12:50:39 |
| - | Detected.json | 14143 | 2022-10-12 10:54:29 |
| - | Detected[0].png | 689855 | 2022-10-12 10:54:28 |
| - | Detected[1].png | 770058 | 2022-10-12 10:54:28 |
| - | Detected[2].png | 703895 | 2022-10-12 10:54:29 |
| - | Detected[3].png | 784575 | 2022-10-12 10:54:29 |
| - | Diabola Chiliham (OC) - Character Sheet [Comm].json | 10552 | 2020-06-24 01:32:40 |
| - | Diabola Chiliham (OC) - Character Sheet [Comm][0].png | 590899 | 2020-06-24 01:32:40 |
| - | Diabola Chiliham (OC) - Character Sheet [Comm][1].png | 636176 | 2020-06-24 01:32:46 |
| - | Diggersby - Commission.json | 12038 | 2018-11-19 14:18:27 |
| - | Dixie Kong - Oooh Bananaa.json | 12052 | 2020-06-18 18:02:36 |
| - | Dixie Kong - Oooh Bananaa[0].png | 545943 | 2020-06-18 18:02:36 |
| - | Dixie Kong - Oooh Bananaa[1].png | 629760 | 2020-06-18 18:02:36 |
| - | Dixie Kong - Oooh Bananaa[2].png | 617614 | 2020-06-18 18:02:36 |
| - | Do you have some eggs?.json | 13444 | 2022-04-20 10:21:12 |
| - | Do you have some eggs?[0].png | 841747 | 2022-04-20 10:21:11 |
| - | Do you have some eggs?[1].png | 742458 | 2022-04-20 10:21:12 |
| - | Do you have some eggs?[2].png | 794785 | 2022-04-20 10:21:12 |
| - | Don't Feed the Pandas [Comm].json | 19278 | 2020-01-11 22:17:27 |
| - | Don't Feed the Pandas [Comm][0].png | 1216931 | 2020-01-11 22:17:26 |
| - | Don't Feed the Pandas [Comm][1].png | 1239642 | 2020-01-11 22:17:26 |
| - | Don't Feed the Pandas [Comm][2].png | 734826 | 2020-01-11 22:17:26 |
| - | Don't Feed the Pandas [Comm][3].png | 743698 | 2020-01-11 22:17:27 |
| - | Don't Feed the Pandas [Comm][4].png | 689710 | 2020-01-11 22:17:27 |
| - | Don't Feed the Pandas [Comm][5].png | 693732 | 2020-01-11 22:17:27 |
| - | Dr. Voir [Comm].json | 14457 | 2020-07-30 16:58:35 |
| - | Dr. Voir [Comm][0].png | 699935 | 2020-07-30 16:58:31 |
| - | Dr. Voir [Comm][1].png | 636420 | 2020-07-30 16:58:33 |
| - | Dr. Voir [Comm][2].png | 663782 | 2020-07-30 16:58:35 |
| - | Dr. Voir [Comm][3].png | 605443 | 2020-07-30 16:58:36 |
| - | Dragonite [Patreon Comm].json | 14986 | 2020-01-11 16:29:56 |
| - | Dragonite [Patreon Comm][0].png | 1004940 | 2020-01-11 16:29:56 |
| - | Dragonite [Patreon Comm][1].png | 791167 | 2020-01-11 16:29:56 |
| - | Dragonite [Patreon Comm][2].png | 698995 | 2020-01-11 16:29:56 |
| - | Dragonite [Patreon Comm][3].png | 714215 | 2020-01-11 16:29:57 |
| - | Dusk - Commission.json | 5235 | 2018-11-19 13:16:25 |
| - | Elizabeth's Reward [Patreon Comm].json | 13533 | 2020-03-13 19:35:12 |
| - | Elizabeth's Reward [Patreon Comm][0].png | 1094470 | 2020-03-13 19:35:11 |
| - | Elizabeth's Reward [Patreon Comm][1].png | 1099277 | 2020-03-13 19:35:11 |
| - | Elizabeth's Reward [Patreon Comm][2].png | 995396 | 2020-03-13 19:35:12 |
| - | Elizabeth's Reward [Patreon Comm][3].png | 1092970 | 2020-03-13 19:35:12 |
| - | Elora - Spyro Reignited Trilogy.json | 7671 | 2018-11-24 05:13:29 |
| - | Elora - Spyro Reignited Trilogy.png | 763239 | 2018-11-24 05:13:29 |
| - | Elora X Spyro.json | 7572 | 2018-11-24 05:21:35 |
| - | Elora X Spyro.png | 783640 | 2018-11-24 05:21:35 |
| - | Erie - "Flame" Charge [Comm].json | 17135 | 2021-10-22 03:38:21 |
| - | Erie - "Flame" Charge [Comm][0].png | 669722 | 2021-10-22 03:38:19 |
| - | Erie - "Flame" Charge [Comm][1].png | 744380 | 2021-10-22 03:38:20 |
| - | Erie - "Flame" Charge [Comm][2].png | 745543 | 2021-10-22 03:38:20 |
| - | Erie - "Flame" Charge [Comm][3].png | 660386 | 2021-10-22 03:38:21 |
| - | Erie - "Flame" Charge [Comm][4].png | 661828 | 2021-10-22 03:38:21 |
| - | Expectant Milfs - Commission.json | 7370 | 2018-11-22 03:54:39 |
| - | Fate Valentine [Comm].json | 7217 | 2020-06-24 01:17:33 |
| - | Fate Valentine [Comm].png | 549436 | 2020-06-24 01:17:36 |
| - | Felicia - Commission [CROP].json | 6747 | 2018-11-21 13:01:19 |
| - | Felicia - OC [Comm].json | 17296 | 2021-10-21 13:52:17 |
| - | Felicia - OC [Comm][0].png | 381806 | 2021-10-21 13:52:16 |
| - | Felicia - OC [Comm][1].png | 333923 | 2021-10-21 13:52:16 |
| - | Felicia - OC [Comm][2].png | 432063 | 2021-10-21 13:52:16 |
| - | Felicia - OC [Comm][3].png | 378632 | 2021-10-21 13:52:17 |
| - | Felicia - OC [Comm][4].png | 484167 | 2021-10-21 13:52:17 |
| - | Felicia - OC [Comm][5].png | 424951 | 2021-10-21 13:52:17 |
| - | Felicia.json | 5076 | 2018-11-19 06:22:41 |
| - | Fibell Luxbell.json | 16362 | 2020-09-15 07:05:43 |
| - | Fibell Luxbell[0].png | 533873 | 2020-09-15 07:05:39 |
| - | Fibell Luxbell[1].png | 536767 | 2020-09-15 07:05:41 |
| - | Fibell Luxbell[2].png | 521184 | 2020-09-15 07:05:42 |
| - | Fibell Luxbell[3].png | 524216 | 2020-09-15 07:05:43 |
| - | Fibell Luxbell[4].png | 537860 | 2020-09-15 07:05:44 |
| - | Fiera 2 [Patreon Comm].json | 7992 | 2020-01-11 20:38:22 |
| - | Fiera 2 [Patreon Comm].png | 785029 | 2020-01-11 20:38:23 |
| - | Fiera 3 [Patreon Comm].json | 7857 | 2020-03-13 19:35:10 |
| - | Fiera 3 [Patreon Comm].png | 683606 | 2020-03-13 19:35:10 |
| - | Fiera [Patreon Comm].json | 6934 | 2018-11-24 02:06:31 |
| - | Fiera [Patreon Comm].png | 622763 | 2018-11-24 02:06:31 |
| - | Fiona - Bribing the authorities [Patreon Comm].json | 11203 | 2020-09-26 05:30:24 |
| - | Fiona - Bribing the authorities [Patreon Comm][0].png | 924561 | 2020-09-26 05:30:24 |
| - | Fiona - Bribing the authorities [Patreon Comm][1].png | 937269 | 2020-09-26 05:30:28 |
| - | Fiona Fox ❤️ [Patreon Comm].json | 7956 | 2019-04-24 02:07:07 |
| - | Fiona Fox ❤️ [Patreon Comm].png | 666365 | 2019-04-24 02:07:07 |
| - | Fiona's Funbags 🍈🍈 [Comm].json | 10627 | 2020-01-12 04:10:14 |
| - | Fiona's Funbags 🍈🍈 [Comm][0].png | 737399 | 2020-01-12 04:10:14 |
| - | Fiona's Funbags 🍈🍈 [Comm][1].png | 500265 | 2020-01-12 04:10:14 |
| - | Fiona's Funbags 🍈🍈 [Patreon Comm].json | 11210 | 2019-09-27 23:25:21 |
| - | Fiona's Funbags 🍈🍈 [Patreon Comm][0].png | 750350 | 2019-09-27 23:25:21 |
| - | Fluttershy.json | 5735 | 2018-11-21 19:03:29 |
| - | Francine Yagami X JY [Comm].json | 13484 | 2019-04-10 00:08:03 |
| - | Francine Yagami X JY [Comm][0].png | 682928 | 2019-04-10 00:08:02 |
| - | Francine Yagami X JY [Comm][1].png | 766248 | 2019-04-10 00:08:03 |
| - | Francine Yagami X JY [Comm][2].png | 868562 | 2019-04-10 00:08:03 |
| - | Gal in charge.json | 11922 | 2023-04-02 11:09:21 |
| - | Gal in charge[0].png | 579031 | 2023-04-02 11:09:20 |
| - | Gal in charge[1].png | 548341 | 2023-04-02 11:09:21 |
| - | Gal in charge[2].png | 553464 | 2023-04-02 11:09:22 |
| - | Gardevoir & Gothitelle 2.json | 6283 | 2018-11-19 06:26:37 |
| - | Gardevoir & Gothitelle 3.json | 5616 | 2018-11-19 09:23:02 |
| - | Gardevoir & Gothitelle~.json | 7284 | 2018-11-18 23:44:02 |
| - | Gardevoir [Patreon Comm].json | 9573 | 2019-02-16 01:45:48 |
| - | Gardevoir [Patreon Comm][0].png | 710368 | 2019-02-16 01:45:48 |
| - | Gardevoir [Patreon Comm][1].png | 712591 | 2019-02-16 01:45:48 |
| - | Gatomon - Commission.json | 5385 | 2018-11-19 12:38:55 |
| - | Gauss - OC [Comm].json | 10591 | 2020-08-19 16:17:59 |
| - | Gauss - OC [Comm][0].png | 445202 | 2020-08-19 16:17:59 |
| - | Gauss - OC [Comm][1].png | 594546 | 2020-08-19 16:18:00 |
| - | Getting Fit with Amy 👀💦 [Comm].json | 13803 | 2020-01-11 16:17:23 |
| - | Getting Fit with Amy 👀💦 [Comm][0].png | 644199 | 2020-01-11 16:17:23 |
| - | Getting Fit with Amy 👀💦 [Comm][1].png | 865107 | 2020-01-11 16:17:23 |
| - | Getting Fit with Amy 👀💦 [Comm][2].png | 839555 | 2020-01-11 16:17:23 |
| - | Getting Fit with Amy 👀💦 [Comm][3].png | 678701 | 2020-01-11 16:17:24 |
| - | Gilda - Commission.json | 6653 | 2018-11-21 21:52:03 |
| - | Gilly the Kobold.json | 8512 | 2018-11-24 13:36:01 |
| - | Gilly the Kobold.png | 822245 | 2018-11-24 13:36:01 |
| - | Giratina [Patreon Comm].json | 7818 | 2019-03-02 00:09:01 |
| - | Giratina [Patreon Comm].png | 659719 | 2019-03-02 00:09:01 |
| - | Gloria [Patreon Comm].json | 7862 | 2020-01-17 13:08:34 |
| - | Gloria [Patreon Comm].png | 489969 | 2020-01-17 13:08:34 |
| - | Goodra 2 [Patreon Comm].json | 8041 | 2020-01-12 04:18:25 |
| - | Goodra 2 [Patreon Comm].png | 691072 | 2020-01-12 04:18:25 |
| - | Goodra 3 [Patreon Comm].json | 14841 | 2020-01-12 04:18:27 |
| - | Goodra 3 [Patreon Comm][0].png | 578039 | 2020-01-12 04:18:26 |
| - | Goodra 3 [Patreon Comm][1].png | 642023 | 2020-01-12 04:18:27 |
| - | Goodra 3 [Patreon Comm][2].png | 645165 | 2020-01-12 04:18:27 |
| - | Goodra 3 [Patreon Comm][3].png | 655579 | 2020-01-12 04:18:27 |
| - | Goodra [Patreon Comm].json | 14397 | 2020-01-11 20:32:22 |
| - | Goodra [Patreon Comm][0].png | 609964 | 2020-01-11 20:32:22 |
| - | Goodra [Patreon Comm][1].png | 613264 | 2020-01-11 20:32:22 |
| - | Goodra [Patreon Comm][2].png | 641491 | 2020-01-11 20:32:22 |
| - | Goodra [Patreon Comm][3].png | 645133 | 2020-01-11 20:32:23 |
| - | Goth Gal’s Wardrobe Malfunction [Comm].json | 14592 | 2021-11-08 21:01:01 |
| - | Goth Gal’s Wardrobe Malfunction [Comm][0].png | 853631 | 2021-11-08 21:01:01 |
| - | Goth Gal’s Wardrobe Malfunction [Comm][1].png | 965159 | 2021-11-08 21:01:01 |
| - | Goth Gal’s Wardrobe Malfunction [Comm][2].png | 879168 | 2021-11-08 21:01:01 |
| - | Goth Gal’s Wardrobe Malfunction [Comm][3].png | 992063 | 2021-11-08 21:01:02 |
| - | Greninja [Patreon Comm].json | 7487 | 2019-02-01 03:21:12 |
| - | Greninja [Patreon Comm].png | 3169874 | 2019-02-01 03:21:13 |
| - | Guilt - Commission.json | 7004 | 2018-11-22 12:44:55 |
| - | Gwynn - Commission.json | 7463 | 2018-11-22 12:19:40 |
| - | Hariet - SFP 2 (2021).json | 14293 | 2021-03-08 21:33:17 |
| - | Hariet - SFP 2 (2021)[0].png | 483282 | 2021-03-08 21:33:15 |
| - | Hariet - SFP 2 (2021)[1].png | 501900 | 2021-03-08 21:33:16 |
| - | Hariet - SFP 2 (2021)[2].png | 397000 | 2021-03-08 21:33:17 |
| - | Hariet - SFP 2 (2021)[3].png | 420116 | 2021-03-08 21:33:18 |
| - | Harriet - Broodal.json | 6870 | 2018-11-22 13:30:09 |
| - | Have no fear! Amy Rose is here!.json | 20619 | 2020-09-14 00:24:42 |
| - | Have no fear! Amy Rose is here![0].png | 517652 | 2020-09-14 00:24:37 |
| - | Have no fear! Amy Rose is here![1].png | 552647 | 2020-09-14 00:24:38 |
| - | Have no fear! Amy Rose is here![2].png | 553433 | 2020-09-14 00:24:39 |
| - | Have no fear! Amy Rose is here![3].png | 544985 | 2020-09-14 00:24:40 |
| - | Have no fear! Amy Rose is here![4].png | 538456 | 2020-09-14 00:24:41 |
| - | Have no fear! Amy Rose is here![5].png | 572852 | 2020-09-14 00:24:42 |
| - | Have no fear! Amy Rose is here![6].png | 573598 | 2020-09-14 00:24:43 |
| - | Herm Rose X Tentacles [Patreon Comm].json | 7104 | 2018-11-24 09:33:25 |
| - | Herm Rose X Tentacles [Patreon Comm].png | 806687 | 2018-11-24 09:33:25 |
| - | Hex Maniac - Commission [CROP].json | 6466 | 2018-11-21 12:36:17 |
| - | Hiko [Comm].json | 10601 | 2021-01-19 01:22:27 |
| - | Hiko [Comm][0].png | 586724 | 2021-01-19 01:22:27 |
| - | Hiko [Comm][1].png | 591720 | 2021-01-19 01:22:27 |
| - | Hinata (OC) - Bust Style [Comm].json | 7654 | 2021-11-08 21:01:03 |
| - | Hinata (OC) - Bust Style [Comm].png | 753521 | 2021-11-08 21:01:03 |
| - | Honey Steel - Pirate Captain [Comm].json | 7499 | 2020-03-13 19:35:09 |
| - | Honey Steel - Pirate Captain [Comm].png | 544686 | 2020-03-13 19:35:10 |
| - | Horae Deerling [Comm].json | 6663 | 2018-11-24 11:05:10 |
| - | Horae Deerling [Comm].png | 625691 | 2018-11-24 11:05:10 |
| - | Hot Protocol.json | 11157 | 2022-05-04 10:11:28 |
| - | Hot Protocol[0].png | 1072188 | 2022-05-04 10:11:28 |
| - | Hot Protocol[1].png | 1173915 | 2022-05-04 10:11:28 |
| - | Hui-Min - A Perfect View [Comm].json | 10127 | 2020-06-19 16:08:13 |
| - | Hui-Min - A Perfect View [Comm][0].png | 817458 | 2020-06-19 16:08:13 |
| - | Hui-Min - A Perfect View [Comm][1].png | 738075 | 2020-06-19 16:08:13 |
| - | Hui-Min Goes For a Ride [Comm].json | 10879 | 2020-08-24 18:55:45 |
| - | Hui-Min Goes For a Ride [Comm][0].png | 778441 | 2020-08-24 18:55:45 |
| - | Hui-Min Goes For a Ride [Comm][1].png | 716200 | 2020-08-24 18:55:46 |
| - | Hui-Min X Frapter Bracllard [Comm].json | 11540 | 2020-01-11 14:25:56 |
| - | Hui-Min X Frapter Bracllard [Comm][0].png | 491292 | 2020-01-11 14:25:56 |
| - | Hui-Min X Frapter Bracllard [Comm][1].png | 521865 | 2020-01-11 14:25:56 |
| - | Hui-Min X Penis [Comm].json | 14374 | 2020-01-17 14:05:08 |
| - | Hui-Min X Penis [Comm][0].png | 694206 | 2020-01-17 14:05:08 |
| - | Hui-Min X Penis [Comm][1].png | 765834 | 2020-01-17 14:05:08 |
| - | Hui-Min X Penis [Comm][2].png | 754969 | 2020-01-17 14:05:08 |
| - | Hui-Min X Penis [Comm][3].png | 754706 | 2020-01-17 14:05:09 |
| - | Hui-Min [Patreon Comm].json | 7454 | 2018-11-24 09:17:59 |
| - | Hui-Min [Patreon Comm].png | 494494 | 2018-11-24 09:17:59 |
| - | Hydreigon [Patreon Comm].json | 7692 | 2019-03-19 01:23:38 |
| - | Hydreigon [Patreon Comm].png | 1037730 | 2019-03-19 01:23:40 |
| - | I know what you're looking for ❤️.json | 11664 | 2023-08-02 10:23:48 |
| - | I know what you're looking for ❤️[0].png | 624229 | 2023-08-02 10:23:47 |
| - | I know what you're looking for ❤️[1].png | 640069 | 2023-08-02 10:23:48 |
| - | I know what you're looking for ❤️[2].png | 742801 | 2023-08-02 10:23:48 |
| - | I'm inevitable [Comm].json | 14780 | 2022-03-30 10:46:25 |
| - | I'm inevitable [Comm][0].png | 674747 | 2022-03-30 10:46:23 |
| - | I'm inevitable [Comm][1].png | 750620 | 2022-03-30 10:46:25 |
| - | I'm inevitable [Comm][2].png | 677457 | 2022-03-30 10:46:25 |
| - | I'm inevitable [Comm][3].png | 753378 | 2022-03-30 10:46:26 |
| - | Isabelle! 🍃.json | 12292 | 2018-11-24 08:56:17 |
| - | Isabelle! 🍃[0].png | 798022 | 2018-11-24 08:56:17 |
| - | Isabelle! 🍃[1].png | 824729 | 2018-11-24 08:56:17 |
| - | Isabelle! 🍃[2].png | 618086 | 2018-11-24 08:56:17 |
| - | Isamu Kaeru - Character Sheet [Comm].json | 8097 | 2022-02-27 11:56:48 |
| - | Isamu Kaeru - Character Sheet [Comm].png | 717182 | 2022-02-27 11:56:48 |
| - | It's good to be out.json | 14117 | 2023-01-01 11:07:38 |
| - | It's good to be out[0].png | 720398 | 2023-01-01 11:07:38 |
| - | It's good to be out[1].png | 769854 | 2023-01-01 11:07:38 |
| - | It's good to be out[2].png | 848712 | 2023-01-01 11:07:38 |
| - | It's good to be out[3].png | 848134 | 2023-01-01 11:07:38 |
| - | It's really hot here.json | 13100 | 2023-01-01 11:07:15 |
| - | It's really hot here[0].png | 911823 | 2023-01-01 11:07:14 |
| - | It's really hot here[1].png | 936558 | 2023-01-01 11:07:14 |
| - | It's really hot here[2].png | 936080 | 2023-01-01 11:07:15 |
| - | It's 🥥🥥 Time 👀💦.json | 14498 | 2020-08-06 01:19:07 |
| - | It's 🥥🥥 Time 👀💦[0].png | 701510 | 2020-08-06 01:19:04 |
| - | It's 🥥🥥 Time 👀💦[1].png | 719917 | 2020-08-06 01:19:05 |
| - | It's 🥥🥥 Time 👀💦[2].png | 673099 | 2020-08-06 01:19:07 |
| - | It's 🥥🥥 Time 👀💦[3].png | 712314 | 2020-08-06 01:19:08 |
| - | Janice Lyall [Comm].json | 20424 | 2020-05-13 01:55:54 |
| - | Janice Lyall [Comm][0].png | 980877 | 2020-05-13 01:55:51 |
| - | Janice Lyall [Comm][1].png | 1046044 | 2020-05-13 01:55:52 |
| - | Janice Lyall [Comm][2].png | 1042566 | 2020-05-13 01:55:52 |
| - | Janice Lyall [Comm][3].png | 935268 | 2020-05-13 01:55:53 |
| - | Janice Lyall [Comm][4].png | 1054633 | 2020-05-13 01:55:53 |
| - | Janice Lyall [Comm][5].png | 852963 | 2020-05-13 01:55:53 |
| - | Janice Lyall [Comm][6].png | 880050 | 2020-05-13 01:55:54 |
| - | Janice Lyall [Comm][7].png | 855536 | 2020-05-13 01:55:54 |
| - | Jasper [Comm].json | 10733 | 2019-04-17 02:05:47 |
| - | Jasper [Comm][0].png | 779776 | 2019-04-17 02:05:47 |
| - | Jasper [Comm][1].png | 874201 | 2019-04-17 02:05:47 |
| - | Jeanie - Commission.json | 10519 | 2018-11-22 11:35:05 |
| - | Jenny the Bat - Commission.json | 8447 | 2018-11-19 12:57:40 |
| - | Jenny's Prom Pickup! 💙.json | 9844 | 2023-04-02 11:10:22 |
| - | Jenny's Prom Pickup! 💙[0].png | 628582 | 2023-04-02 11:10:22 |
| - | Jenny's Prom Pickup! 💙[1].png | 628360 | 2023-04-02 11:10:22 |
| - | Jet X Taokaka - Commission.json | 6579 | 2018-11-21 23:38:33 |
| - | Jewel X Frapter Bracllard [Patreon Comm].json | 15504 | 2019-09-22 11:19:44 |
| - | Jewel X Frapter Bracllard [Patreon Comm][0].png | 640791 | 2019-09-22 11:19:43 |
| - | Jewel X Frapter Bracllard [Patreon Comm][1].png | 804232 | 2019-09-22 11:19:44 |
| - | Jewel X Frapter Bracllard [Patreon Comm][2].png | 943307 | 2019-09-22 11:19:44 |
| - | Jewel X Frapter Bracllard [Patreon Comm][3].png | 951733 | 2019-09-22 11:19:45 |
| - | Jonah - A Relaxing Pint [Comm].json | 7856 | 2022-02-27 11:56:49 |
| - | Jonah - A Relaxing Pint [Comm].png | 744250 | 2022-02-27 11:56:50 |
| - | Justine [Comm].json | 7468 | 2021-11-08 21:00:42 |
| - | Justine [Comm].png | 692946 | 2021-11-08 21:00:42 |
| - | Kally - Bust Style [Comm].json | 16825 | 2021-10-25 14:04:28 |
| - | Kally - Bust Style [Comm][0].png | 969370 | 2021-10-25 14:04:25 |
| - | Kally - Bust Style [Comm][1].png | 1058490 | 2021-10-25 14:04:25 |
| - | Kally - Bust Style [Comm][2].png | 976838 | 2021-10-25 14:04:26 |
| - | Kally - Bust Style [Comm][3].png | 879648 | 2021-10-25 14:04:27 |
| - | Kally - Bust Style [Comm][4].png | 961561 | 2021-10-25 14:04:28 |
| - | Kally - Bust Style [Comm][5].png | 884829 | 2021-10-25 14:04:29 |
| - | Kalx Ink - OC [Comm].json | 17473 | 2020-09-28 12:29:05 |
| - | Kalx Ink - OC [Comm][0].png | 922890 | 2020-09-28 12:28:58 |
| - | Kalx Ink - OC [Comm][1].png | 925271 | 2020-09-28 12:29:02 |
| - | Kalx Ink - OC [Comm][2].png | 953500 | 2020-09-28 12:29:03 |
| - | Kalx Ink - OC [Comm][3].png | 924892 | 2020-09-28 12:29:04 |
| - | Kalx Ink - OC [Comm][4].png | 927360 | 2020-09-28 12:29:05 |
| - | Kalx Ink - OC [Comm][5].png | 955817 | 2020-09-28 12:29:06 |
| - | Kanani - Beach Bikini Slip [Comm].json | 10528 | 2020-09-29 13:28:30 |
| - | Kanani - Beach Bikini Slip [Comm][0].png | 675182 | 2020-09-29 13:28:30 |
| - | Kanani - Beach Bikini Slip [Comm][1].png | 700647 | 2020-09-29 13:28:31 |
| - | Kangaskhan [Patreon Comm].json | 7782 | 2019-02-01 04:04:03 |
| - | Kangaskhan [Patreon Comm].png | 662719 | 2019-02-01 04:04:04 |
| - | Kanna Kamui [Comm].json | 7222 | 2018-11-24 05:46:18 |
| - | Kanna Kamui [Comm].png | 561526 | 2018-11-24 05:46:19 |
| - | Kanna Master Zero🍈🍈🚿.json | 17523 | 2022-09-11 10:29:47 |
| - | Kanna Master Zero🍈🍈🚿[0].png | 828431 | 2022-09-11 10:29:46 |
| - | Kanna Master Zero🍈🍈🚿[1].png | 788136 | 2022-09-11 10:29:46 |
| - | Kanna Master Zero🍈🍈🚿[2].png | 799022 | 2022-09-11 10:29:47 |
| - | Kanna Master Zero🍈🍈🚿[3].png | 780102 | 2022-09-11 10:29:47 |
| - | Kanna Master Zero🍈🍈🚿[4].png | 665881 | 2022-09-11 10:29:47 |
| - | Kanna Master Zero🍈🍈🚿[5].png | 662447 | 2022-09-11 10:29:47 |
| - | Kaori - OC [Comm].json | 10243 | 2020-09-28 09:20:24 |
| - | Kaori - OC [Comm][0].png | 719373 | 2020-09-28 09:20:24 |
| - | Kaori - OC [Comm][1].png | 693989 | 2020-09-28 09:20:26 |
| - | Kaori Fumokoshi [Comm].json | 10911 | 2019-02-01 00:49:41 |
| - | Kaori Fumokoshi [Comm][0].png | 742308 | 2019-02-01 00:49:41 |
| - | Kaori Fumokoshi [Comm][1].png | 734926 | 2019-02-01 00:49:42 |
| - | Karin Bigheart - My OC [NSFW].json | 7384 | 2018-11-22 23:53:50 |
| - | Karin Bigheart X Frapter [Patreon Comm].json | 11506 | 2019-03-22 23:30:10 |
| - | Karin Bigheart X Frapter [Patreon Comm][0].png | 667560 | 2019-03-22 23:30:10 |
| - | Karin Bigheart X Frapter [Patreon Comm][1].png | 675265 | 2019-03-22 23:30:10 |
| - | Karin Bigheart [Patreon Comm].json | 7936 | 2018-11-24 14:18:04 |
| - | Karin Bigheart [Patreon Comm].png | 457022 | 2018-11-24 14:18:04 |
| - | Karin Bigheart! [Patreon Comm].json | 11311 | 2020-01-12 01:03:46 |
| - | Karin Bigheart! [Patreon Comm][0].png | 532679 | 2020-01-12 01:03:46 |
| - | Karin Bigheart! [Patreon Comm][1].png | 596202 | 2020-01-12 01:03:46 |
| - | Kenza [Patreon Comm].json | 7249 | 2018-11-24 11:44:59 |
| - | Kenza [Patreon Comm].png | 568770 | 2018-11-24 11:44:59 |
| - | Kimi Yagami - Commission [Character Sheet].json | 7362 | 2018-11-23 09:48:18 |
| - | Kimi Yagami - Commission [Character Sheet].png | 1324121 | 2018-11-23 09:48:18 |
| - | Kimi Yagami - Commission.json | 9712 | 2018-11-23 08:24:41 |
| - | Kimi Yagami 2 - Commission.json | 15597 | 2018-11-23 08:39:19 |
| - | Kimi Yagami 2 - Commission[0].png | 288993 | 2018-11-23 08:39:18 |
| - | Kimi Yagami 2 - Commission[1].png | 292063 | 2018-11-23 08:39:19 |
| - | Kimi Yagami 2 - Commission[2].png | 308933 | 2018-11-23 08:39:19 |
| - | Kimi Yagami 2 - Commission[3].png | 355616 | 2018-11-23 08:39:19 |
| - | Kimi Yagami 2 - Commission[4].png | 240986 | 2018-11-23 08:39:19 |
| - | Kirlia [ArtTrade].json | 14477 | 2019-02-01 04:11:22 |
| - | Kirlia [ArtTrade][0].png | 537781 | 2019-02-01 04:11:21 |
| - | Kirlia [ArtTrade][1].png | 547478 | 2019-02-01 04:11:22 |
| - | Kirlia [ArtTrade][2].png | 518720 | 2019-02-01 04:11:22 |
| - | Kirlia [ArtTrade][3].png | 536333 | 2019-02-01 04:11:22 |
| - | Klara Chameleoness - Commission.json | 8488 | 2018-11-23 11:19:52 |
| - | Klara Chameleoness - Commission.png | 691262 | 2018-11-23 11:19:52 |
| - | Ko Busty Boxing: Round 2 🥊.json | 13498 | 2022-09-11 10:29:26 |
| - | Ko Busty Boxing: Round 2 🥊[0].png | 783862 | 2022-09-11 10:29:26 |
| - | Ko Busty Boxing: Round 2 🥊[1].png | 802504 | 2022-09-11 10:29:26 |
| - | Ko Busty Boxing: Round 2 🥊[2].png | 851022 | 2022-09-11 10:29:26 |
| - | Ko Busty Boxing: Round 2 🥊[3].png | 776288 | 2022-09-11 10:29:27 |
| - | Kona (OC) [Comm].json | 14835 | 2020-01-11 19:29:07 |
| - | Kona (OC) [Comm][0].png | 867184 | 2020-01-11 19:29:06 |
| - | Kona (OC) [Comm][1].png | 963693 | 2020-01-11 19:29:06 |
| - | Kona (OC) [Comm][2].png | 969814 | 2020-01-11 19:29:07 |
| - | Kona (OC) [Comm][3].png | 988138 | 2020-01-11 19:29:07 |
| - | Krystal's "trouble" [Comm].json | 22782 | 2020-09-30 02:13:31 |
| - | Krystal's "trouble" [Comm][0].png | 885536 | 2020-09-30 02:13:23 |
| - | Krystal's "trouble" [Comm][1].png | 963987 | 2020-09-30 02:13:24 |
| - | Krystal's "trouble" [Comm][2].png | 882183 | 2020-09-30 02:13:26 |
| - | Krystal's "trouble" [Comm][3].png | 961912 | 2020-09-30 02:13:27 |
| - | Krystal's "trouble" [Comm][4].png | 894598 | 2020-09-30 02:13:28 |
| - | Krystal's "trouble" [Comm][5].png | 962815 | 2020-09-30 02:13:29 |
| - | Krystal's "trouble" [Comm][6].png | 870538 | 2020-09-30 02:13:31 |
| - | Krystal's "trouble" [Comm][7].png | 920221 | 2020-09-30 02:13:32 |
| - | Lammy Lamb - Commission.json | 6629 | 2018-11-21 14:42:21 |
| - | Lancelittle [Comm].json | 12593 | 2020-01-17 14:38:12 |
| - | Lancelittle [Comm][0].png | 508702 | 2020-01-17 14:38:12 |
| - | Lancelittle [Comm][1].png | 629458 | 2020-01-17 14:38:12 |
| - | Lancelittle [Comm][2].png | 1106208 | 2020-01-17 14:38:12 |
| - | Lanolin 🥛.json | 13938 | 2023-04-02 11:16:13 |
| - | Lanolin 🥛[0].png | 564797 | 2023-04-02 11:16:12 |
| - | Lanolin 🥛[1].png | 555829 | 2023-04-02 11:16:12 |
| - | Lanolin 🥛[2].png | 574680 | 2023-04-02 11:16:13 |
| - | Lanolin 🥛[3].png | 588281 | 2023-04-02 11:16:13 |
| - | Layla - Commission.json | 6079 | 2018-11-19 13:17:33 |
| - | Lei X Lei Yin - Commission.json | 9910 | 2018-11-23 03:37:22 |
| - | Lei-Yin (OC) - Character Sheet [2024].json | 7878 | 2024-06-05 10:10:10 |
| - | Lei-Yin (OC) - Character Sheet [2024].png | 1305304 | 2024-06-05 10:10:10 |
| - | Lei-Yin - Bust Style [Comm].json | 14864 | 2021-01-09 04:30:51 |
| - | Lei-Yin - Bust Style [Comm][0].png | 431453 | 2021-01-09 04:30:48 |
| - | Lei-Yin - Bust Style [Comm][1].png | 475721 | 2021-01-09 04:30:50 |
| - | Lei-Yin - Bust Style [Comm][2].png | 474040 | 2021-01-09 04:30:51 |
| - | Lei-Yin - Bust Style [Comm][3].png | 462790 | 2021-01-09 04:30:52 |
| - | Lei-Yin X Hui-Min - Commission.json | 12122 | 2018-11-23 04:28:09 |
| - | Lei-Yin X Nila Stern - Commission.json | 15195 | 2018-11-23 08:25:20 |
| - | Lei-Yin [Comm].json | 7707 | 2018-11-24 05:11:24 |
| - | Lei-Yin [Comm].png | 852471 | 2018-11-24 05:11:25 |
| - | Lei-Yin's Booty [Patreon Comm].json | 8257 | 2020-01-12 15:49:10 |
| - | Lei-Yin's Booty [Patreon Comm].png | 748723 | 2020-01-12 15:49:10 |
| - | Lei-Yin's Invitation [Comm].json | 10908 | 2018-12-18 03:07:40 |
| - | Lei-Yin's Invitation [Comm][0].png | 427614 | 2018-12-18 03:07:40 |
| - | Lei-Yin's Invitation [Comm][1].png | 500372 | 2018-12-18 03:07:40 |
| - | Lei-Yin's Panda Booty 🐼💕 [Patreon Comm].json | 11412 | 2020-01-11 16:49:23 |
| - | Lei-Yin's Panda Booty 🐼💕 [Patreon Comm][0].png | 762050 | 2020-01-11 16:49:23 |
| - | Lei-Yin's Panda Booty 🐼💕 [Patreon Comm][1].png | 783962 | 2020-01-11 16:49:23 |
| - | Lei-Yin's Snack Time [Patreon Comm].json | 14408 | 2020-05-13 02:59:38 |
| - | Lei-Yin's Snack Time [Patreon Comm][0].png | 1017624 | 2020-05-13 02:59:37 |
| - | Lei-Yin's Snack Time [Patreon Comm][1].png | 1021519 | 2020-05-13 02:59:38 |
| - | Lei-Yin's Snack Time [Patreon Comm][2].png | 1024681 | 2020-05-13 02:59:38 |
| - | Lei-Yin's Snack Time [Patreon Comm][3].png | 1028636 | 2020-05-13 02:59:38 |
| - | Lei-Yin, Mu-shi & Hui-Min - My OCs [NSFW].json | 13348 | 2018-11-23 02:50:45 |
| - | Lesly Wolfess [Patreon Comm].json | 7360 | 2020-01-11 14:31:39 |
| - | Lesly Wolfess [Patreon Comm].png | 690314 | 2020-01-11 14:31:39 |
| - | Let's do this~.json | 11959 | 2020-11-24 07:23:45 |
| - | Let's do this~[0].png | 577005 | 2020-11-24 07:23:43 |
| - | Let's do this~[1].png | 550034 | 2020-11-24 07:23:45 |
| - | Let's do this~[2].png | 508415 | 2020-11-24 07:23:48 |
| - | Lien-Da.json | 15723 | 2023-08-02 10:22:59 |
| - | Lien-Da[0].png | 451035 | 2023-08-02 10:22:59 |
| - | Lien-Da[1].png | 487121 | 2023-08-02 10:22:59 |
| - | Lien-Da[2].png | 468187 | 2023-08-02 10:22:59 |
| - | Lien-Da[3].png | 522068 | 2023-08-02 10:22:59 |
| - | Lien-Da[4].png | 479553 | 2023-08-02 10:22:59 |
| - | Lina (OC) [Comm].json | 10857 | 2020-01-11 18:38:45 |
| - | Lina (OC) [Comm][0].png | 600371 | 2020-01-11 18:38:45 |
| - | Lina (OC) [Comm][1].png | 681343 | 2020-01-11 18:38:45 |
| - | Lina the Ghoul - OC [Comm].json | 7929 | 2020-05-13 02:10:12 |
| - | Lina the Ghoul - OC [Comm].png | 805439 | 2020-05-13 02:10:12 |
| - | Lina the Ghoul 😚 [Patreon Comm].json | 7717 | 2019-04-25 00:31:57 |
| - | Lina the Ghoul 😚 [Patreon Comm].png | 817828 | 2019-04-25 00:31:57 |
| - | Little Carrot, Big Stuffing [Comm].json | 56981 | 2022-02-13 12:31:10 |
| - | Little Carrot, Big Stuffing [Comm][0].png | 1461584 | 2022-02-13 12:31:03 |
| - | Little Carrot, Big Stuffing [Comm][10].png | 1533379 | 2022-02-13 12:31:06 |
| - | Little Carrot, Big Stuffing [Comm][11].png | 1546492 | 2022-02-13 12:31:06 |
| - | Little Carrot, Big Stuffing [Comm][12].png | 1420100 | 2022-02-13 12:31:06 |
| - | Little Carrot, Big Stuffing [Comm][13].png | 1548116 | 2022-02-13 12:31:06 |
| - | Little Carrot, Big Stuffing [Comm][14].png | 1705402 | 2022-02-13 12:31:07 |
| - | Little Carrot, Big Stuffing [Comm][15].png | 1816218 | 2022-02-13 12:31:07 |
| - | Little Carrot, Big Stuffing [Comm][16].png | 1851037 | 2022-02-13 12:31:07 |
| - | Little Carrot, Big Stuffing [Comm][17].png | 1863873 | 2022-02-13 12:31:07 |
| - | Little Carrot, Big Stuffing [Comm][18].png | 1830088 | 2022-02-13 12:31:08 |
| - | Little Carrot, Big Stuffing [Comm][19].png | 1358259 | 2022-02-13 12:31:08 |
| - | Little Carrot, Big Stuffing [Comm][1].png | 1628203 | 2022-02-13 12:31:03 |
| - | Little Carrot, Big Stuffing [Comm][20].png | 1528253 | 2022-02-13 12:31:08 |
| - | Little Carrot, Big Stuffing [Comm][21].png | 1417316 | 2022-02-13 12:31:08 |
| - | Little Carrot, Big Stuffing [Comm][22].png | 1540024 | 2022-02-13 12:31:09 |
| - | Little Carrot, Big Stuffing [Comm][23].png | 1544079 | 2022-02-13 12:31:09 |
| - | Little Carrot, Big Stuffing [Comm][24].png | 1701278 | 2022-02-13 12:31:09 |
| - | Little Carrot, Big Stuffing [Comm][25].png | 1808819 | 2022-02-13 12:31:09 |
| - | Little Carrot, Big Stuffing [Comm][26].png | 1844547 | 2022-02-13 12:31:10 |
| - | Little Carrot, Big Stuffing [Comm][27].png | 1856261 | 2022-02-13 12:31:10 |
| - | Little Carrot, Big Stuffing [Comm][2].png | 1646211 | 2022-02-13 12:31:04 |
| - | Little Carrot, Big Stuffing [Comm][3].png | 1521334 | 2022-02-13 12:31:04 |
| - | Little Carrot, Big Stuffing [Comm][4].png | 1644647 | 2022-02-13 12:31:04 |
| - | Little Carrot, Big Stuffing [Comm][5].png | 1800592 | 2022-02-13 12:31:04 |
| - | Little Carrot, Big Stuffing [Comm][6].png | 1829892 | 2022-02-13 12:31:04 |
| - | Little Carrot, Big Stuffing [Comm][7].png | 1818954 | 2022-02-13 12:31:05 |
| - | Little Carrot, Big Stuffing [Comm][8].png | 1846005 | 2022-02-13 12:31:05 |
| - | Little Carrot, Big Stuffing [Comm][9].png | 1362625 | 2022-02-13 12:31:05 |
| - | Little Kitty 🍃.json | 16171 | 2023-01-01 11:09:46 |
| - | Little Kitty 🍃[0].png | 576651 | 2023-01-01 11:09:46 |
| - | Little Kitty 🍃[1].png | 579341 | 2023-01-01 11:09:46 |
| - | Little Kitty 🍃[2].png | 587647 | 2023-01-01 11:09:46 |
| - | Little Kitty 🍃[3].png | 590371 | 2023-01-01 11:09:46 |
| - | Little Kitty 🍃[4].png | 595818 | 2023-01-01 11:09:47 |
| - | Little Meg [Comm].json | 10217 | 2021-11-08 21:01:08 |
| - | Little Meg [Comm][0].png | 1031332 | 2021-11-08 21:01:08 |
| - | Little Meg [Comm][1].png | 1089699 | 2021-11-08 21:01:09 |
| - | Little Smile [Comm].json | 16943 | 2021-10-22 02:18:50 |
| - | Little Smile [Comm][0].png | 742102 | 2021-10-22 02:18:49 |
| - | Little Smile [Comm][1].png | 756581 | 2021-10-22 02:18:49 |
| - | Little Smile [Comm][2].png | 765058 | 2021-10-22 02:18:50 |
| - | Little Smile [Comm][3].png | 766528 | 2021-10-22 02:18:50 |
| - | Little Smile [Comm][4].png | 780636 | 2021-10-22 02:18:51 |
| - | Lopa's Bunny Buns [Comm].json | 14009 | 2022-04-20 10:09:00 |
| - | Lopa's Bunny Buns [Comm][0].png | 562375 | 2022-04-20 10:09:00 |
| - | Lopa's Bunny Buns [Comm][1].png | 583288 | 2022-04-20 10:09:00 |
| - | Lopa's Bunny Buns [Comm][2].png | 559738 | 2022-04-20 10:09:00 |
| - | Lopa's Bunny Buns [Comm][3].png | 580726 | 2022-04-20 10:09:00 |
| - | Lopa's Squishy Boobs! [Comm].json | 14211 | 2022-05-21 17:31:33 |
| - | Lopa's Squishy Boobs! [Comm][0].png | 674194 | 2022-05-21 17:31:32 |
| - | Lopa's Squishy Boobs! [Comm][1].png | 721646 | 2022-05-21 17:31:33 |
| - | Lopa's Squishy Boobs! [Comm][2].png | 672289 | 2022-05-21 17:31:33 |
| - | Lopa's Squishy Boobs! [Comm][3].png | 719557 | 2022-05-21 17:31:33 |
| - | Lopunny.json | 5193 | 2018-11-18 21:41:46 |
| - | Loy Miyazaki X Hui-Min [Comm].json | 10902 | 2019-05-14 19:07:18 |
| - | Loy Miyazaki X Hui-Min [Comm][0].png | 676227 | 2019-05-14 19:07:18 |
| - | Loy Miyazaki X Hui-Min [Comm][1].png | 765470 | 2019-05-14 19:07:18 |
| - | Loyal Servants.json | 13025 | 2023-04-02 11:09:59 |
| - | Loyal Servants[0].png | 542009 | 2023-04-02 11:09:59 |
| - | Loyal Servants[1].png | 559268 | 2023-04-02 11:09:59 |
| - | Loyal Servants[2].png | 654863 | 2023-04-02 11:09:59 |
| - | Loyal Servants[3].png | 692459 | 2023-04-02 11:09:59 |
| - | Ludovica [Patreon Comm].json | 7194 | 2020-01-11 12:20:40 |
| - | Ludovica [Patreon Comm].png | 913936 | 2020-01-11 12:20:40 |
| - | Lugia 🥛 [Patreon Comm].json | 11425 | 2019-04-26 01:01:05 |
| - | Lugia 🥛 [Patreon Comm][0].png | 507175 | 2019-04-26 01:01:05 |
| - | Lugia 🥛 [Patreon Comm][1].png | 514105 | 2019-04-26 01:01:06 |
| - | Lulu's Cute [Comm].json | 22385 | 2022-03-27 10:46:06 |
| - | Lulu's Cute [Comm][0].png | 1086007 | 2022-03-27 10:45:59 |
| - | Lulu's Cute [Comm][1].png | 994064 | 2022-03-27 10:46:01 |
| - | Lulu's Cute [Comm][2].png | 1006560 | 2022-03-27 10:46:02 |
| - | Lulu's Cute [Comm][3].png | 1015366 | 2022-03-27 10:46:03 |
| - | Lulu's Cute [Comm][4].png | 917979 | 2022-03-27 10:46:04 |
| - | Lulu's Cute [Comm][5].png | 847861 | 2022-03-27 10:46:05 |
| - | Lulu's Cute [Comm][6].png | 860657 | 2022-03-27 10:46:06 |
| - | Lulu's Cute [Comm][7].png | 870249 | 2022-03-27 10:46:06 |
| - | Lupe X Mina - Commission.json | 7722 | 2018-11-22 14:04:00 |
| - | Luvalind Blue 2 [Patreon Comm].json | 10417 | 2020-01-12 14:49:50 |
| - | Luvalind Blue 2 [Patreon Comm][0].png | 764256 | 2020-01-12 14:49:50 |
| - | Luvalind Blue 2 [Patreon Comm][1].png | 793276 | 2020-01-12 14:49:50 |
| - | Luvalind Blue [Patreon Comm].json | 10328 | 2020-01-12 09:37:53 |
| - | Luvalind Blue [Patreon Comm][0].png | 670366 | 2020-01-12 09:37:53 |
| - | Luvalind Blue [Patreon Comm][1].png | 806086 | 2020-01-12 09:37:53 |
| - | MY PATREON [MATOSPECTORU].json | 6544 | 2018-11-23 22:43:02 |
| - | MY PATREON [MATOSPECTORU].png | 630883 | 2018-11-23 22:43:02 |
| - | Macha X Red - Commission.json | 6619 | 2018-11-22 12:14:33 |
| - | Mackenzie - Bashful beaver butt [Comm].json | 13881 | 2021-03-04 06:43:22 |
| - | Mackenzie - Bashful beaver butt [Comm][0].png | 577893 | 2021-03-04 06:43:17 |
| - | Mackenzie - Bashful beaver butt [Comm][1].png | 568447 | 2021-03-04 06:43:19 |
| - | Mackenzie - Bashful beaver butt [Comm][2].png | 612301 | 2021-03-04 06:43:22 |
| - | Mackenzie - Bashful beaver butt [Comm][3].png | 602805 | 2021-03-04 06:43:24 |
| - | Mad Mew Mew.json | 17783 | 2018-11-24 13:25:41 |
| - | Mad Mew Mew[0].png | 515441 | 2018-11-24 13:25:40 |
| - | Mad Mew Mew[1].png | 508195 | 2018-11-24 13:25:40 |
| - | Mad Mew Mew[2].png | 516130 | 2018-11-24 13:25:40 |
| - | Mad Mew Mew[3].png | 474727 | 2018-11-24 13:25:40 |
| - | Mad Mew Mew[4].png | 525942 | 2018-11-24 13:25:41 |
| - | Mad Mew Mew[5].png | 492417 | 2018-11-24 13:25:41 |
| - | Magic Problems?.json | 12070 | 2023-08-02 10:23:08 |
| - | Magic Problems?[0].png | 801929 | 2023-08-02 10:23:08 |
| - | Magic Problems?[1].png | 800795 | 2023-08-02 10:23:08 |
| - | Magic Problems?[2].png | 768186 | 2023-08-02 10:23:08 |
| - | Maia Acheron.json | 14617 | 2023-01-01 11:06:21 |
| - | Maia Acheron[0].png | 584698 | 2023-01-01 11:06:21 |
| - | Maia Acheron[1].png | 643412 | 2023-01-01 11:06:21 |
| - | Maia Acheron[2].png | 620670 | 2023-01-01 11:06:21 |
| - | Maia Acheron[3].png | 701429 | 2023-01-01 11:06:21 |
| - | Makoto Nanaya - Commission.json | 6338 | 2018-11-19 13:25:34 |
| - | Mariah Tanning ☀️[Patreon Comm].json | 22282 | 2020-09-26 05:31:39 |
| - | Mariah Tanning ☀️[Patreon Comm][0].png | 1641022 | 2020-09-26 05:31:15 |
| - | Mariah Tanning ☀️[Patreon Comm][1].png | 1600767 | 2020-09-26 05:31:19 |
| - | Mariah Tanning ☀️[Patreon Comm][2].png | 1603737 | 2020-09-26 05:31:22 |
| - | Mariah Tanning ☀️[Patreon Comm][3].png | 1617669 | 2020-09-26 05:31:26 |
| - | Mariah Tanning ☀️[Patreon Comm][4].png | 1579287 | 2020-09-26 05:31:30 |
| - | Mariah Tanning ☀️[Patreon Comm][5].png | 1527639 | 2020-09-26 05:31:33 |
| - | Mariah Tanning ☀️[Patreon Comm][6].png | 1531921 | 2020-09-26 05:31:39 |
| - | Mariah Tanning ☀️[Patreon Comm][7].png | 1518622 | 2020-09-26 05:31:44 |
| - | Marvelous Mounds❗️.json | 12423 | 2023-04-16 11:04:15 |
| - | Marvelous Mounds❗️[0].png | 579786 | 2023-04-16 11:04:15 |
| - | Marvelous Mounds❗️[1].png | 557121 | 2023-04-16 11:04:15 |
| - | Marvelous Mounds❗️[2].png | 637652 | 2023-04-16 11:04:16 |
| - | Mary Sue's Exercises [Patreon Comm].json | 10461 | 2020-06-10 03:19:25 |
| - | Mary Sue's Exercises [Patreon Comm][0].png | 769858 | 2020-06-10 03:19:25 |
| - | Mary Sue's Exercises [Patreon Comm][1].png | 736576 | 2020-06-10 03:19:25 |
| - | MatoSpectoru Zone [DISCORD] (English_Spanish).json | 7492 | 2018-11-24 01:25:01 |
| - | MatoSpectoru Zone [DISCORD] (English_Spanish).png | 169034 | 2018-11-24 01:25:01 |
| - | Max X Peg - Commission.json | 9900 | 2018-11-22 04:55:53 |
| - | Medli~.json | 5388 | 2018-11-19 00:09:56 |
| - | Megaera ❤️[Patreon Comm].json | 7519 | 2019-04-27 00:18:12 |
| - | Megaera ❤️[Patreon Comm].png | 869507 | 2019-04-27 00:18:13 |
| - | Meloetta - FCS 1 [2017].json | 6448 | 2018-11-21 19:06:25 |
| - | Meloetta.json | 4848 | 2018-11-18 21:41:46 |
| - | Merry Christmas and Happy Holidays!! (2018).json | 8479 | 2019-02-01 01:25:06 |
| - | Merry Christmas and Happy Holidays!! (2018).png | 1532281 | 2019-02-01 01:25:06 |
| - | Mewtwo - Pokemon - MFP8.json | 16523 | 2020-01-17 13:15:44 |
| - | Mewtwo - Pokemon - MFP8[0].png | 482222 | 2020-01-17 13:15:44 |
| - | Mewtwo - Pokemon - MFP8[1].png | 471719 | 2020-01-17 13:15:44 |
| - | Mewtwo - Pokemon - MFP8[2].png | 454715 | 2020-01-17 13:15:44 |
| - | Mewtwo - Pokemon - MFP8[3].png | 479389 | 2020-01-17 13:15:44 |
| - | Mewtwo - Pokemon - MFP8[4].gif | 9065050 | 2020-01-17 13:15:45 |
| - | Michelle [Comm].json | 10668 | 2019-05-14 02:24:52 |
| - | Michelle [Comm][0].png | 548107 | 2019-05-14 02:24:52 |
| - | Michelle [Comm][1].png | 566627 | 2019-05-14 02:24:53 |
| - | Midna - Christmas Is Coming [Patreon Comm].json | 8669 | 2018-12-06 03:18:08 |
| - | Midna - Christmas Is Coming [Patreon Comm].png | 766981 | 2018-12-06 03:18:08 |
| - | Midna - Dakimakura (Watermark) [Comm].json | 7544 | 2018-11-23 21:36:25 |
| - | Midna - Dakimakura (Watermark) [Comm].png | 840449 | 2018-11-23 21:36:26 |
| - | Midna - FCS 1 [2017].json | 6706 | 2018-11-21 18:55:56 |
| - | Midna - FCS+ [2018].json | 9825 | 2018-11-23 02:27:46 |
| - | Midna - Hyper Breasts [Patreon Comm].json | 7810 | 2018-11-24 06:09:56 |
| - | Midna - Hyper Breasts [Patreon Comm].png | 377186 | 2018-11-24 06:09:56 |
| - | Midna - MFP N.4 (November).json | 11771 | 2018-12-01 08:09:22 |
| - | Midna - MFP N.4 (November)[0].png | 940661 | 2018-12-01 08:09:22 |
| - | Midna - MFP N.4 (November)[1].png | 426147 | 2018-12-01 08:09:23 |
| - | Midna - Tsuyu Asui's Outfit [Patreon Comm].json | 8017 | 2018-11-24 11:26:12 |
| - | Midna - Tsuyu Asui's Outfit [Patreon Comm].png | 829950 | 2018-11-24 11:26:13 |
| - | Midna 13.json | 6538 | 2018-11-19 02:09:56 |
| - | Midna 14.json | 7979 | 2018-11-19 06:13:26 |
| - | Midna 19.json | 5232 | 2018-11-19 09:22:38 |
| - | Midna 20.json | 9281 | 2018-11-19 10:49:45 |
| - | Midna 21.json | 8593 | 2018-11-19 12:47:55 |
| - | Midna 3.json | 10222 | 2018-11-18 21:42:26 |
| - | Midna 5.json | 5813 | 2018-11-18 23:01:52 |
| - | Midna 6.json | 10257 | 2018-11-18 23:52:55 |
| - | Midna 8.json | 9414 | 2018-11-19 00:08:23 |
| - | Midna 9.json | 5053 | 2018-11-19 00:31:30 |
| - | Midna [Remake 2018].json | 8968 | 2018-11-24 02:13:57 |
| - | Midna [Remake 2018].png | 1067221 | 2018-11-24 02:13:57 |
| - | Midna in Gerudo Desert [Comm].json | 7684 | 2018-11-23 21:36:26 |
| - | Midna in Gerudo Desert [Comm].png | 1205373 | 2018-11-23 21:36:28 |
| - | Midna new addiction [Part 1].json | 17589 | 2023-04-02 11:10:06 |
| - | Midna new addiction [Part 1][0].png | 870761 | 2023-04-02 11:10:06 |
| - | Midna new addiction [Part 1][1].png | 875459 | 2023-04-02 11:10:06 |
| - | Midna new addiction [Part 1][2].png | 889497 | 2023-04-02 11:10:06 |
| - | Midna new addiction [Part 1][3].png | 863161 | 2023-04-02 11:10:06 |
| - | Midna new addiction [Part 1][4].png | 933963 | 2023-04-02 11:10:06 |
| - | Midna new addiction [Part 1][5].png | 926268 | 2023-04-02 11:10:07 |
| - | Midna new addiction [Part 2].json | 15735 | 2023-04-02 11:10:15 |
| - | Midna new addiction [Part 2][0].png | 739619 | 2023-04-02 11:10:14 |
| - | Midna new addiction [Part 2][1].png | 780663 | 2023-04-02 11:10:14 |
| - | Midna new addiction [Part 2][2].png | 750023 | 2023-04-02 11:10:15 |
| - | Midna new addiction [Part 2][3].png | 1028677 | 2023-04-02 11:10:15 |
| - | Midna new addiction [Part 2][4].png | 967664 | 2023-04-02 11:10:15 |
| - | Midna's Attributes 💓.json | 13898 | 2024-06-30 11:25:08 |
| - | Midna's Attributes 💓[0].png | 2142162 | 2024-06-30 11:25:08 |
| - | Midna's Attributes 💓[1].png | 2178703 | 2024-06-30 11:25:08 |
| - | Midna's Attributes 💓[2].png | 2163932 | 2024-06-30 11:25:09 |
| - | Midna.json | 5990 | 2018-11-18 21:41:47 |
| - | Midnah.json | 17969 | 2023-08-02 10:23:39 |
| - | Midnah[0].png | 547070 | 2023-08-02 10:23:38 |
| - | Midnah[1].png | 510361 | 2023-08-02 10:23:39 |
| - | Midnah[2].png | 494596 | 2023-08-02 10:23:39 |
| - | Midnah[3].png | 502509 | 2023-08-02 10:23:39 |
| - | Midnah[4].png | 504197 | 2023-08-02 10:23:39 |
| - | Midnah[5].png | 486796 | 2023-08-02 10:23:39 |
| - | Midnah[6].png | 488537 | 2023-08-02 10:23:40 |
| - | Midnass.json | 11063 | 2020-05-25 01:32:20 |
| - | Midnass[0].png | 782828 | 2020-05-25 01:32:20 |
| - | Midnass[1].png | 815548 | 2020-05-25 01:32:20 |
| - | Mienshao's Training (1_2) [Comm].json | 12494 | 2020-06-18 18:02:35 |
| - | Mienshao's Training (1_2) [Comm][0].png | 620398 | 2020-06-18 18:02:35 |
| - | Mienshao's Training (1_2) [Comm][1].png | 616299 | 2020-06-18 18:02:35 |
| - | Mienshao's Training (1_2) [Comm][2].png | 628436 | 2020-06-18 18:02:35 |
| - | Mienshao's Training (2_2) [Comm].json | 11145 | 2020-06-19 16:08:10 |
| - | Mienshao's Training (2_2) [Comm][0].png | 578805 | 2020-06-19 16:08:10 |
| - | Mienshao's Training (2_2) [Comm][1].png | 638694 | 2020-06-19 16:08:10 |
| - | Millie - Commission.json | 8575 | 2018-11-22 12:19:43 |
| - | Millie Isis [Comm].json | 8524 | 2020-09-28 09:19:50 |
| - | Millie Isis [Comm][0].png | 484699 | 2020-09-28 09:19:50 |
| - | Millie Isis [Comm][1].png | 527965 | 2020-09-28 09:19:51 |
| - | Mina Mongoose - Commission.json | 12738 | 2018-11-22 11:05:49 |
| - | Mina Mongoose - Don't Keep Her Waiting 🎵 [Patreon Comm].json | 8134 | 2020-01-11 14:31:46 |
| - | Mina Mongoose - Don't Keep Her Waiting 🎵 [Patreon Comm].png | 1038874 | 2020-01-11 14:31:46 |
| - | Mina Mongoose - Sound Trip 🎶 [Comm].json | 11241 | 2019-07-13 03:50:34 |
| - | Mina Mongoose - Sound Trip 🎶 [Comm][0].png | 786187 | 2019-07-13 03:50:34 |
| - | Mina Mongoose - Sound Trip 🎶 [Comm][1].png | 786786 | 2019-07-13 03:50:35 |
| - | Mina Mongoose [Comm].json | 14896 | 2020-01-17 16:06:49 |
| - | Mina Mongoose [Comm][0].png | 544914 | 2020-01-17 16:06:49 |
| - | Mina Mongoose [Comm][1].png | 515260 | 2020-01-17 16:06:49 |
| - | Mina Mongoose [Comm][2].png | 576309 | 2020-01-17 16:06:49 |
| - | Mina Mongoose [Comm][3].png | 712858 | 2020-01-17 16:06:50 |
| - | Mina X Zeena - Commission.json | 18197 | 2018-11-22 16:59:23 |
| - | Mina's Backstage 🍑.json | 13334 | 2022-09-11 10:28:57 |
| - | Mina's Backstage 🍑[0].png | 762287 | 2022-09-11 10:28:56 |
| - | Mina's Backstage 🍑[1].png | 792584 | 2022-09-11 10:28:57 |
| - | Mina's Backstage 🍑[2].png | 719495 | 2022-09-11 10:28:57 |
| - | Minnie - Commission.json | 6768 | 2018-11-22 23:14:35 |
| - | Missy - Commission.json | 11306 | 2018-11-23 03:28:39 |
| - | Molly - Not Candy [Comm].json | 8448 | 2020-11-27 04:27:44 |
| - | Molly - Not Candy [Comm].png | 655198 | 2020-11-27 04:27:46 |
| - | Molly - Special cargo [Comm].json | 12140 | 2020-07-08 18:30:22 |
| - | Molly - Special cargo [Comm][0].png | 585987 | 2020-07-08 18:30:20 |
| - | Molly - Special cargo [Comm][1].png | 565342 | 2020-07-08 18:30:21 |
| - | Molly - Special cargo [Comm][2].png | 507121 | 2020-07-08 18:30:23 |
| - | Momo the Crasher [Comm].json | 7570 | 2020-11-21 03:47:00 |
| - | Momo the Crasher [Comm].png | 648117 | 2020-11-21 03:47:04 |
| - | Mozu [Gigantic].json | 6123 | 2018-11-22 14:15:15 |
| - | Mrs. Shy - Halloween Costume [Comm].json | 11872 | 2018-11-24 11:20:50 |
| - | Mrs. Shy - Halloween Costume [Comm][0].png | 865800 | 2018-11-24 11:20:50 |
| - | Mrs. Shy - Halloween Costume [Comm][1].png | 859643 | 2018-11-24 11:20:50 |
| - | Mu-Shi & Hui-Min X Rutmutt [Commission].json | 18046 | 2018-11-23 03:18:52 |
| - | Mu-Shi X Frapter Bracllard [Patreon Comm].json | 12432 | 2020-01-11 14:26:02 |
| - | Mu-Shi X Frapter Bracllard [Patreon Comm][0].png | 593822 | 2020-01-11 14:26:02 |
| - | Mu-Shi X Frapter Bracllard [Patreon Comm][1].png | 605587 | 2020-01-11 14:26:02 |
| - | Mu-Shi X Karva Okada [Comm].json | 9664 | 2020-01-11 14:50:27 |
| - | Mu-Shi X Karva Okada [Comm].png | 634253 | 2020-01-11 14:50:27 |
| - | Mu-Shi X Pan [Comm].json | 10902 | 2018-11-24 04:43:54 |
| - | Mu-Shi X Pan [Comm][0].png | 635946 | 2018-11-24 04:43:54 |
| - | Mu-Shi X Pan [Comm][1].png | 639121 | 2018-11-24 04:43:54 |
| - | Mu-Shi's "Full" Belly [Patreon Comm].json | 12651 | 2018-12-13 18:23:41 |
| - | Mu-Shi's "Full" Belly [Patreon Comm][0].png | 835038 | 2018-12-13 18:23:41 |
| - | Mu-Shi's "Full" Belly [Patreon Comm][1].png | 849178 | 2018-12-13 18:23:42 |
| - | Mu-Shi's Filling [Comm].json | 11425 | 2020-08-24 18:55:40 |
| - | Mu-Shi's Filling [Comm][0].png | 719894 | 2020-08-24 18:55:40 |
| - | Mu-Shi's Filling [Comm][1].png | 721847 | 2020-08-24 18:55:41 |
| - | Mu-Shi, Juicy Panda Booty [Patreon Comm].json | 8499 | 2019-02-14 04:22:39 |
| - | Mu-Shi, Juicy Panda Booty [Patreon Comm].png | 526608 | 2019-02-14 04:22:40 |
| - | Muffet - Bust Style [Patreon Comm].json | 18750 | 2020-01-12 03:58:50 |
| - | Muffet - Bust Style [Patreon Comm][0].png | 645540 | 2020-01-12 03:58:49 |
| - | Muffet - Bust Style [Patreon Comm][1].png | 692367 | 2020-01-12 03:58:49 |
| - | Muffet - Bust Style [Patreon Comm][2].png | 789206 | 2020-01-12 03:58:49 |
| - | Muffet - Bust Style [Patreon Comm][3].png | 606292 | 2020-01-12 03:58:50 |
| - | Muffet - Bust Style [Patreon Comm][4].png | 628851 | 2020-01-12 03:58:50 |
| - | Muffet - Bust Style [Patreon Comm][5].png | 652825 | 2020-01-12 03:58:50 |
| - | Muffet.json | 8212 | 2018-11-19 14:21:24 |
| - | My OC Lei-Yin 2023 🐼💦.json | 11312 | 2024-01-03 11:19:07 |
| - | My OC Lei-Yin 2023 🐼💦[0].png | 1772142 | 2024-01-03 11:19:06 |
| - | My OC Lei-Yin 2023 🐼💦[1].png | 1749740 | 2024-01-03 11:19:07 |
| - | My OC Lei-Yin 2023 🐼💦[2].png | 1787489 | 2024-01-03 11:19:07 |
| - | My OCs (NSFW) [VOTE TIME].json | 18135 | 2018-11-23 21:47:45 |
| - | My OCs (NSFW) [VOTE TIME][0].png | 975252 | 2018-11-23 21:47:40 |
| - | My OCs (NSFW) [VOTE TIME][1].png | 294748 | 2018-11-23 21:47:41 |
| - | My OCs (NSFW) [VOTE TIME][2].png | 304044 | 2018-11-23 21:47:42 |
| - | My OCs (NSFW) [VOTE TIME][3].png | 248074 | 2018-11-23 21:47:43 |
| - | My OCs (NSFW) [VOTE TIME][4].png | 441247 | 2018-11-23 21:47:44 |
| - | My OCs (NSFW) [VOTE TIME][5].png | 701393 | 2018-11-23 21:47:45 |
| - | My OCs (NSFW) [VOTE TIME][6].png | 878381 | 2018-11-23 21:47:45 |
| - | Naadia Lucario [Comm].json | 7203 | 2018-11-24 04:30:05 |
| - | Naadia Lucario [Comm].png | 564295 | 2018-11-24 04:30:06 |
| - | Nebula [Comm].json | 14470 | 2021-10-21 06:43:24 |
| - | Nebula [Comm][0].png | 933477 | 2021-10-21 06:43:23 |
| - | Nebula [Comm][1].png | 942934 | 2021-10-21 06:43:24 |
| - | Nebula [Comm][2].png | 959410 | 2021-10-21 06:43:24 |
| - | Nebula [Comm][3].png | 960505 | 2021-10-21 06:43:25 |
| - | Neeko - League of Legends.json | 10620 | 2018-11-26 17:49:53 |
| - | Neeko - League of Legends[0].png | 856846 | 2018-11-26 17:49:53 |
| - | Neeko - League of Legends[1].png | 865318 | 2018-11-26 17:49:54 |
| - | Nemo - Magical Mishap 👀💦 [Comm].json | 7528 | 2020-01-12 10:47:49 |
| - | Nemo - Magical Mishap 👀💦 [Comm].png | 841694 | 2020-01-12 10:47:49 |
| - | New Submission.json | 11985 | 2023-08-20 11:15:39 |
| - | New Submission[0].png | 485919 | 2023-08-20 11:15:39 |
| - | New Submission[1].png | 541629 | 2023-08-20 11:15:39 |
| - | New Submission[2].png | 590896 | 2023-08-20 11:15:40 |
| - | New Yoga Position [Comm].json | 7988 | 2021-11-08 21:00:57 |
| - | New Yoga Position [Comm].png | 1133929 | 2021-11-08 21:00:57 |
| - | Niani Davis [Comm].json | 11017 | 2020-01-17 16:08:52 |
| - | Niani Davis [Comm][0].png | 448521 | 2020-01-17 16:08:52 |
| - | Niani Davis [Comm][1].png | 549990 | 2020-01-17 16:08:52 |
| - | Nicole Butterson 🍑.gif | 13243059 | 2023-04-19 10:14:32 |
| - | Nicole Butterson 🍑.json | 7795 | 2023-04-19 10:14:32 |
| - | Nicole Watterson - A Good Day [Comm].json | 19507 | 2019-05-05 04:25:46 |
| - | Nicole Watterson - A Good Day [Comm][0].png | 576675 | 2019-05-05 04:25:44 |
| - | Nicole Watterson - A Good Day [Comm][1].png | 590110 | 2019-05-05 04:25:44 |
| - | Nicole Watterson - A Good Day [Comm][2].png | 597990 | 2019-05-05 04:25:45 |
| - | Nicole Watterson - A Good Day [Comm][3].png | 565139 | 2019-05-05 04:25:45 |
| - | Nicole Watterson - A Good Day [Comm][4].png | 569743 | 2019-05-05 04:25:45 |
| - | Nicole Watterson - A Good Day [Comm][5].png | 586239 | 2019-05-05 04:25:46 |
| - | Nicole Watterson - A Good Day [Comm][6].png | 618870 | 2019-05-05 04:25:46 |
| - | Nicole Watterson [Comm].json | 12934 | 2018-11-24 15:20:55 |
| - | Nicole Watterson [Comm][0].png | 524638 | 2018-11-24 15:20:54 |
| - | Nicole Watterson [Comm][1].png | 555121 | 2018-11-24 15:20:55 |
| - | Nicole Watterson [Comm][2].png | 542352 | 2018-11-24 15:20:56 |
| - | Nicole Watterson [Patreon Comm].json | 12549 | 2019-02-01 03:36:28 |
| - | Nicole Watterson [Patreon Comm][0].png | 427359 | 2019-02-01 03:36:28 |
| - | Nicole Watterson [Patreon Comm][1].png | 658763 | 2019-02-01 03:36:28 |
| - | Nicole Watterson x2 [Comm].json | 8739 | 2019-02-22 00:10:37 |
| - | Nicole Watterson x2 [Comm].png | 448508 | 2019-02-22 00:10:37 |
| - | Nicole [Comm].json | 15061 | 2019-09-22 11:10:36 |
| - | Nicole [Comm][0].png | 1266820 | 2019-09-22 11:10:35 |
| - | Nicole [Comm][1].png | 1361092 | 2019-09-22 11:10:35 |
| - | Nicole [Comm][2].png | 739272 | 2019-09-22 11:10:36 |
| - | Nicole [Comm][3].png | 788348 | 2019-09-22 11:10:36 |
| - | Nicole's Life.json | 7850 | 2022-02-27 11:56:27 |
| - | Nicole's Life.png | 1237342 | 2022-02-27 11:56:27 |
| - | Nila Stern - My OC [WIP].json | 8601 | 2018-11-22 12:54:14 |
| - | Nila Stern - My OC.json | 9152 | 2018-11-22 12:57:15 |
| - | Nila Stern X Frapter Bracllard [Patreon Comm].json | 11655 | 2020-01-11 16:35:55 |
| - | Nila Stern X Frapter Bracllard [Patreon Comm][0].png | 932482 | 2020-01-11 16:35:55 |
| - | Nila Stern X Frapter Bracllard [Patreon Comm][1].png | 776226 | 2020-01-11 16:35:55 |
| - | Nila Stern swallowing the Mic [Patreon Comm].json | 15064 | 2020-01-17 14:03:02 |
| - | Nila Stern swallowing the Mic [Patreon Comm][0].png | 828126 | 2020-01-17 14:03:02 |
| - | Nila Stern swallowing the Mic [Patreon Comm][1].png | 925716 | 2020-01-17 14:03:02 |
| - | Nila Stern swallowing the Mic [Patreon Comm][2].png | 935778 | 2020-01-17 14:03:02 |
| - | Nila Stern swallowing the Mic [Patreon Comm][3].png | 939251 | 2020-01-17 14:03:02 |
| - | Nila's Buttload 😏 [Patreon Comm].json | 7803 | 2020-01-17 15:23:57 |
| - | Nila's Buttload 😏 [Patreon Comm].png | 510143 | 2020-01-17 15:23:58 |
| - | Nila's Favorite Seat [Patreon Comm].json | 11184 | 2020-01-12 03:10:23 |
| - | Nila's Favorite Seat [Patreon Comm][0].png | 614919 | 2020-01-12 03:10:23 |
| - | Nila's Favorite Seat [Patreon Comm][1].png | 718375 | 2020-01-12 03:10:23 |
| - | Niu Swiftreed - Commission.json | 5355 | 2018-11-19 13:16:25 |
| - | Noah - Commission.json | 6165 | 2018-11-22 07:23:29 |
| - | Nya! Nippon Ichi! [Comm].json | 11186 | 2020-09-26 05:29:45 |
| - | Nya! Nippon Ichi! [Comm][0].png | 614160 | 2020-09-26 05:29:45 |
| - | Nya! Nippon Ichi! [Comm][1].png | 618459 | 2020-09-26 05:29:50 |
| - | Nya…I haven’t eaten yet… 😽.json | 10763 | 2022-10-12 10:56:45 |
| - | Nya…I haven’t eaten yet… 😽[0].png | 613978 | 2022-10-12 10:56:45 |
| - | Nya…I haven’t eaten yet… 😽[1].png | 593084 | 2022-10-12 10:56:45 |
| - | Onistal _Midna Helmet - Commission.json | 5135 | 2018-11-19 13:16:24 |
| - | Open Commissions - Round 1.json | 11601 | 2018-11-21 14:55:33 |
| - | Open Commissions - Round 2 [2017].json | 11668 | 2018-11-21 20:06:15 |
| - | Open Commissions - Round 3 [2017].json | 18731 | 2018-11-21 21:40:35 |
| - | Orange Lust [Comm].json | 18878 | 2020-12-15 17:27:03 |
| - | Orange Lust [Comm][0].png | 622332 | 2020-12-15 17:26:51 |
| - | Orange Lust [Comm][1].png | 681894 | 2020-12-15 17:26:53 |
| - | Orange Lust [Comm][2].png | 692515 | 2020-12-15 17:26:57 |
| - | Orange Lust [Comm][3].png | 715372 | 2020-12-15 17:27:00 |
| - | Orange Lust [Comm][4].png | 725331 | 2020-12-15 17:27:03 |
| - | Orange Lust [Comm][5].png | 735645 | 2020-12-15 17:27:06 |
| - | Orikomi - Commission.json | 5115 | 2018-11-19 13:16:24 |
| - | Penny's New Form [Comm].json | 19066 | 2020-12-15 17:29:55 |
| - | Penny's New Form [Comm][0].png | 589564 | 2020-12-15 17:29:46 |
| - | Penny's New Form [Comm][1].png | 605601 | 2020-12-15 17:29:48 |
| - | Penny's New Form [Comm][2].png | 490678 | 2020-12-15 17:29:51 |
| - | Penny's New Form [Comm][3].png | 522000 | 2020-12-15 17:29:53 |
| - | Penny's New Form [Comm][4].png | 509399 | 2020-12-15 17:29:55 |
| - | Penny's New Form [Comm][5].png | 541351 | 2020-12-15 17:29:59 |
| - | Pepper - OC [Comm].json | 8724 | 2021-10-21 18:15:14 |
| - | Pepper - OC [Comm].png | 575123 | 2021-10-21 18:15:15 |
| - | Peri. [Comm].json | 14831 | 2021-10-20 17:00:24 |
| - | Peri. [Comm][0].png | 1467250 | 2021-10-20 17:00:23 |
| - | Peri. [Comm][1].png | 1479998 | 2021-10-20 17:00:24 |
| - | Peri. [Comm][2].png | 1560268 | 2021-10-20 17:00:24 |
| - | Peri. [Comm][3].png | 1561753 | 2021-10-20 17:00:25 |
| - | Petra [ArtTrade].json | 10423 | 2020-01-17 12:11:23 |
| - | Petra [ArtTrade][0].png | 736887 | 2020-01-17 12:11:23 |
| - | Petra [ArtTrade][1].png | 771426 | 2020-01-17 12:11:24 |
| - | Phaniva - Commission.json | 5595 | 2018-11-19 13:16:25 |
| - | Pheromosa - Commission.json | 9417 | 2018-11-21 15:07:41 |
| - | Pheromosa _ Inanna [Patreon Comm].json | 14685 | 2020-09-26 11:12:10 |
| - | Pheromosa _ Inanna [Patreon Comm][0].png | 1050144 | 2020-09-26 11:12:06 |
| - | Pheromosa _ Inanna [Patreon Comm][1].png | 1066595 | 2020-09-26 11:12:08 |
| - | Pheromosa _ Inanna [Patreon Comm][2].png | 826900 | 2020-09-26 11:12:10 |
| - | Pheromosa _ Inanna [Patreon Comm][3].png | 840489 | 2020-09-26 11:12:11 |
| - | Pinkie Pie - Cow Suit [Anthro].json | 11039 | 2018-11-21 19:18:25 |
| - | Pinkie Pie .json | 5577 | 2018-11-18 21:41:47 |
| - | Pinkie Pie.json | 9782 | 2018-11-21 19:18:21 |
| - | Pixxy X Moraka [Patreon Comm].json | 14816 | 2020-01-12 05:54:51 |
| - | Pixxy X Moraka [Patreon Comm][0].png | 932378 | 2020-01-12 05:54:50 |
| - | Pixxy X Moraka [Patreon Comm][1].png | 918987 | 2020-01-12 05:54:51 |
| - | Pixxy X Moraka [Patreon Comm][2].png | 1035288 | 2020-01-12 05:54:51 |
| - | Pixxy X Moraka [Patreon Comm][3].png | 1021176 | 2020-01-12 05:54:51 |
| - | Polly Esther 2.json | 9429 | 2018-11-18 22:47:54 |
| - | Polly Esther 3.json | 6495 | 2018-11-19 01:39:23 |
| - | Polly spread her....json | 5758 | 2018-11-18 21:57:04 |
| - | Poppy - Commission.json | 6481 | 2018-11-21 14:55:21 |
| - | Poppy X Rai [Comm].json | 10719 | 2018-11-23 13:55:43 |
| - | Poppy X Rai [Comm][0].png | 691012 | 2018-11-23 13:55:43 |
| - | Poppy X Rai [Comm][1].png | 667947 | 2018-11-23 13:55:43 |
| - | Poppy [FCS+ 2].json | 10246 | 2018-11-24 00:20:10 |
| - | Poppy [FCS+ 2][0].png | 544034 | 2018-11-24 00:20:10 |
| - | Poppy [FCS+ 2][1].png | 546782 | 2018-11-24 00:20:11 |
| - | Portia Pierce [Comm].json | 6851 | 2018-11-24 08:38:19 |
| - | Portia Pierce [Comm].png | 777731 | 2018-11-24 08:38:19 |
| - | Primarina - Tentacle Panic [Patreon Comm].json | 11762 | 2020-01-17 12:58:49 |
| - | Primarina - Tentacle Panic [Patreon Comm][0].png | 1019373 | 2020-01-17 12:58:49 |
| - | Primarina - Tentacle Panic [Patreon Comm][1].png | 1035126 | 2020-01-17 12:58:50 |
| - | Princess Ruto .json | 5598 | 2018-11-18 21:42:26 |
| - | Proxy !.json | 5510 | 2018-11-18 22:46:09 |
| - | Queen Alicia - Royal Booty [Patreon Comm].json | 8038 | 2020-02-17 02:17:53 |
| - | Queen Alicia - Royal Booty [Patreon Comm].png | 858749 | 2020-02-17 02:17:54 |
| - | Queen Chrysalis - Commission.json | 29051 | 2018-11-22 09:01:13 |
| - | Queen Novo - Commission.json | 10206 | 2018-11-23 03:54:33 |
| - | Raena Ass [Comm].json | 7718 | 2020-11-24 07:21:34 |
| - | Raena Ass [Comm].png | 618147 | 2020-11-24 07:21:37 |
| - | Rai's thighs [Comm].json | 11058 | 2022-02-27 11:56:30 |
| - | Rai's thighs [Comm][0].png | 547202 | 2022-02-27 11:56:30 |
| - | Rai's thighs [Comm][1].png | 528324 | 2022-02-27 11:56:32 |
| - | Ranamon - HB.json | 7696 | 2019-02-19 00:49:17 |
| - | Ranamon - HB.png | 1007794 | 2019-02-19 00:49:17 |
| - | Ranamon.json | 7598 | 2018-11-20 22:33:07 |
| - | Rarity - Commissions.json | 5496 | 2018-11-21 11:19:35 |
| - | Rarity.json | 5525 | 2018-11-18 21:41:48 |
| - | Raven BIG Leader 💜.json | 13337 | 2024-06-30 11:25:13 |
| - | Raven BIG Leader 💜[0].png | 1747239 | 2024-06-30 11:25:13 |
| - | Raven BIG Leader 💜[1].png | 1735314 | 2024-06-30 11:25:13 |
| - | Raven BIG Leader 💜[2].png | 1700706 | 2024-06-30 11:25:13 |
| - | Ready for any duty [Comm].json | 29185 | 2021-10-25 06:31:40 |
| - | Ready for any duty [Comm][0].png | 588403 | 2021-10-25 06:31:32 |
| - | Ready for any duty [Comm][10].png | 738579 | 2021-10-25 06:31:40 |
| - | Ready for any duty [Comm][11].png | 746755 | 2021-10-25 06:31:40 |
| - | Ready for any duty [Comm][1].png | 624808 | 2021-10-25 06:31:33 |
| - | Ready for any duty [Comm][2].png | 633397 | 2021-10-25 06:31:34 |
| - | Ready for any duty [Comm][3].png | 680133 | 2021-10-25 06:31:35 |
| - | Ready for any duty [Comm][4].png | 632046 | 2021-10-25 06:31:36 |
| - | Ready for any duty [Comm][5].png | 668098 | 2021-10-25 06:31:37 |
| - | Ready for any duty [Comm][6].png | 677050 | 2021-10-25 06:31:37 |
| - | Ready for any duty [Comm][7].png | 722576 | 2021-10-25 06:31:38 |
| - | Ready for any duty [Comm][8].png | 796214 | 2021-10-25 06:31:39 |
| - | Ready for any duty [Comm][9].png | 703528 | 2021-10-25 06:31:40 |
| - | Ready to train (F).json | 9246 | 2023-08-02 10:27:02 |
| - | Ready to train (F)[0].png | 941838 | 2023-08-02 10:27:02 |
| - | Ready to train (F)[1].png | 972785 | 2023-08-02 10:27:02 |
| - | Ready to train (M).json | 9340 | 2023-08-02 10:27:07 |
| - | Ready to train (M)[0].png | 1005647 | 2023-08-02 10:27:07 |
| - | Ready to train (M)[1].png | 1028544 | 2023-08-02 10:27:07 |
| - | Reese~.json | 8188 | 2018-11-19 00:10:46 |
| - | Rei Darkblade showing the goods [Comm].json | 10840 | 2022-02-27 11:56:35 |
| - | Rei Darkblade showing the goods [Comm][0].png | 750041 | 2022-02-27 11:56:35 |
| - | Rei Darkblade showing the goods [Comm][1].png | 682149 | 2022-02-27 11:56:35 |
| - | Relaxing time with Ruby [Comm].json | 10834 | 2021-10-22 18:44:38 |
| - | Relaxing time with Ruby [Comm][0].png | 483501 | 2021-10-22 18:44:38 |
| - | Relaxing time with Ruby [Comm][1].png | 484680 | 2021-10-22 18:44:38 |
| - | Renabutt [Comm].json | 12855 | 2022-03-27 11:07:44 |
| - | Renabutt [Comm][0].png | 714356 | 2022-03-27 11:07:43 |
| - | Renabutt [Comm][1].png | 886390 | 2022-03-27 11:07:44 |
| - | Renabutt [Comm][2].png | 800813 | 2022-03-27 11:07:44 |
| - | Renamon - Commission.json | 9020 | 2018-11-21 13:36:15 |
| - | Renamon - Monthly Fanart Poll N.3 (September).json | 7626 | 2018-11-24 09:36:50 |
| - | Renamon - Monthly Fanart Poll N.3 (September).png | 729955 | 2018-11-24 09:36:50 |
| - | Renamon .json | 6407 | 2018-11-18 21:41:46 |
| - | Renamon X Impmon - Commission.json | 12305 | 2018-11-22 05:47:37 |
| - | Renamon _ Cassandra [Comm].json | 22646 | 2020-09-26 19:59:35 |
| - | Renamon _ Cassandra [Comm][0].png | 822623 | 2020-09-26 19:59:27 |
| - | Renamon _ Cassandra [Comm][1].png | 896666 | 2020-09-26 19:59:28 |
| - | Renamon _ Cassandra [Comm][2].png | 721499 | 2020-09-26 19:59:29 |
| - | Renamon _ Cassandra [Comm][3].png | 787348 | 2020-09-26 19:59:30 |
| - | Renamon _ Cassandra [Comm][4].png | 869726 | 2020-09-26 19:59:32 |
| - | Renamon _ Cassandra [Comm][5].png | 961328 | 2020-09-26 19:59:33 |
| - | Renamon _ Cassandra [Comm][6].png | 733681 | 2020-09-26 19:59:35 |
| - | Renamon _ Cassandra [Comm][7].png | 810170 | 2020-09-26 19:59:36 |
| - | Renard [Comm].json | 6781 | 2018-11-24 07:51:43 |
| - | Renard [Comm].png | 755016 | 2018-11-24 07:51:43 |
| - | Rena🍈🍈.json | 14508 | 2022-07-17 10:11:05 |
| - | Rena🍈🍈[0].png | 1106928 | 2022-07-17 10:11:04 |
| - | Rena🍈🍈[1].png | 1165203 | 2022-07-17 10:11:04 |
| - | Rena🍈🍈[2].png | 1212443 | 2022-07-17 10:11:05 |
| - | Rena🍈🍈[3].png | 1263766 | 2022-07-17 10:11:05 |
| - | Rich in sugars 2 🍬💦.json | 10055 | 2023-04-02 11:15:57 |
| - | Rich in sugars 2 🍬💦[0].png | 686587 | 2023-04-02 11:15:57 |
| - | Rich in sugars 2 🍬💦[1].png | 691096 | 2023-04-02 11:15:58 |
| - | Rich in sugars 🍬💦.json | 6915 | 2023-04-02 11:15:27 |
| - | Rich in sugars 🍬💦.png | 596590 | 2023-04-02 11:15:27 |
| - | Rivet's Cute [Comm].json | 11593 | 2022-02-27 11:57:40 |
| - | Rivet's Cute [Comm][0].png | 818531 | 2022-02-27 11:57:40 |
| - | Rivet's Cute [Comm][1].png | 830993 | 2022-02-27 11:57:40 |
| - | Rocket Love 2 [Comm].json | 16638 | 2022-02-27 11:56:58 |
| - | Rocket Love 2 [Comm][0].png | 668855 | 2022-02-27 11:56:57 |
| - | Rocket Love 2 [Comm][1].png | 681253 | 2022-02-27 11:56:57 |
| - | Rocket Love 2 [Comm][2].png | 709566 | 2022-02-27 11:56:58 |
| - | Rocket Love 2 [Comm][3].png | 721716 | 2022-02-27 11:56:58 |
| - | Rocket Love 2 [Comm][4].png | 712232 | 2022-02-27 11:56:58 |
| - | Rocket Love 3 [Comm].json | 14704 | 2022-02-27 11:57:53 |
| - | Rocket Love 3 [Comm][0].png | 632510 | 2022-02-27 11:57:53 |
| - | Rocket Love 3 [Comm][1].png | 610701 | 2022-02-27 11:57:53 |
| - | Rocket Love 3 [Comm][2].png | 633653 | 2022-02-27 11:57:53 |
| - | Rocket Love 3 [Comm][3].png | 639371 | 2022-02-27 11:57:54 |
| - | Rocket Love [Comm].json | 16176 | 2021-10-18 20:47:35 |
| - | Rocket Love [Comm][0].png | 698410 | 2021-10-18 20:47:33 |
| - | Rocket Love [Comm][1].png | 729570 | 2021-10-18 20:47:34 |
| - | Rocket Love [Comm][2].png | 728410 | 2021-10-18 20:47:34 |
| - | Rocket Love [Comm][3].png | 728044 | 2021-10-18 20:47:35 |
| - | Rocket Love [Comm][4].png | 674057 | 2021-10-18 20:47:35 |
| - | Roo - Cheeky Goblin [Comm].json | 13878 | 2021-02-13 08:44:52 |
| - | Roo - Cheeky Goblin [Comm][0].png | 542568 | 2021-02-13 08:44:47 |
| - | Roo - Cheeky Goblin [Comm][1].png | 556010 | 2021-02-13 08:44:50 |
| - | Roo - Cheeky Goblin [Comm][2].png | 534755 | 2021-02-13 08:44:52 |
| - | Roo - Cheeky Goblin [Comm][3].png | 534300 | 2021-02-13 08:44:54 |
| - | Rouge - Bat Tits Instead of Cake 👀💦 [Comm].json | 14562 | 2020-07-19 02:08:24 |
| - | Rouge - Bat Tits Instead of Cake 👀💦 [Comm][0].png | 852202 | 2020-07-19 02:08:21 |
| - | Rouge - Bat Tits Instead of Cake 👀💦 [Comm][1].png | 892202 | 2020-07-19 02:08:22 |
| - | Rouge - Bat Tits Instead of Cake 👀💦 [Comm][2].png | 836643 | 2020-07-19 02:08:24 |
| - | Rouge - Bat Tits Instead of Cake 👀💦 [Comm][3].png | 868627 | 2020-07-19 02:08:25 |
| - | Rouge 3D Mousepad [ON PRE-ORDER].json | 13619 | 2021-02-27 05:54:23 |
| - | Rouge 3D Mousepad [ON PRE-ORDER][0].png | 925666 | 2021-02-27 05:54:22 |
| - | Rouge 3D Mousepad [ON PRE-ORDER][1].png | 731934 | 2021-02-27 05:54:23 |
| - | Rouge 3D Mousepad [ON PRE-ORDER][2].png | 719579 | 2021-02-27 05:54:24 |
| - | Rouge X Knuckles X Shade [Comm].json | 12126 | 2018-11-23 16:05:05 |
| - | Rouge X Knuckles X Shade [Comm][0].png | 313216 | 2018-11-23 16:05:04 |
| - | Rouge X Knuckles X Shade [Comm][1].png | 202597 | 2018-11-23 16:05:05 |
| - | Rouge X Knuckles X Shade [Comm][2].png | 362504 | 2018-11-23 16:05:05 |
| - | Rouge X Shade 2 [Comm].json | 9705 | 2020-01-12 04:38:53 |
| - | Rouge X Shade 2 [Comm][0].png | 450418 | 2020-01-12 04:38:53 |
| - | Rouge X Shade 2 [Comm][1].png | 485506 | 2020-01-12 04:38:53 |
| - | Rouge X Shade [Sketch] [Comm].json | 14849 | 2020-09-08 15:31:24 |
| - | Rouge X Shade [Sketch] [Comm][0].png | 274616 | 2020-09-08 15:31:20 |
| - | Rouge X Shade [Sketch] [Comm][1].png | 292127 | 2020-09-08 15:31:22 |
| - | Rouge X Shade [Sketch] [Comm][2].png | 291373 | 2020-09-08 15:31:24 |
| - | Rouge X Shade [Sketch] [Comm][3].png | 301419 | 2020-09-08 15:31:26 |
| - | Rouge X Tails - Commission.json | 6926 | 2018-11-22 17:53:41 |
| - | Rouge X Tails 2 - Commission.json | 11769 | 2018-11-22 22:04:02 |
| - | Rouge X Werehog - Commission.json | 10462 | 2018-11-19 12:40:11 |
| - | Rouge X Zeena [Comm].json | 11259 | 2022-02-27 11:57:50 |
| - | Rouge X Zeena [Comm][0].png | 846262 | 2022-02-27 11:57:50 |
| - | Rouge X Zeena [Comm][1].png | 457510 | 2022-02-27 11:57:51 |
| - | Rouge the Bat (Doodle Animation).json | 5673 | 2018-11-19 12:48:51 |
| - | Rouge the Bat - Buttjob.json | 8589 | 2018-11-19 12:43:26 |
| - | Rouge the Bat - Commission.json | 5657 | 2018-11-21 10:46:42 |
| - | Rouge the Bat - MFP11.json | 14382 | 2020-01-11 14:44:26 |
| - | Rouge the Bat - MFP11[0].png | 644222 | 2020-01-11 14:44:25 |
| - | Rouge the Bat - MFP11[1].png | 701732 | 2020-01-11 14:44:26 |
| - | Rouge the Bat - MFP11[2].png | 760301 | 2020-01-11 14:44:26 |
| - | Rouge the Bat - MFP11[3].png | 685859 | 2020-01-11 14:44:26 |
| - | Rouge the Bat - Snoot [Comm].json | 11204 | 2019-04-13 00:02:26 |
| - | Rouge the Bat - Snoot [Comm][0].png | 834293 | 2019-04-13 00:02:26 |
| - | Rouge the Bat - Snoot [Comm][1].png | 826273 | 2019-04-13 00:02:26 |
| - | Rouge the Bat X Candy Kong - Commission.json | 5960 | 2018-11-21 11:10:23 |
| - | Rouge the Bat X Osiris - Commission.json | 8575 | 2018-11-19 13:16:24 |
| - | Rouge the Bat X Tails - Commission.json | 12636 | 2018-11-22 05:40:31 |
| - | Rouge the Bat.json | 5803 | 2018-11-18 23:56:11 |
| - | Rouge the Butt - Commission.json | 9960 | 2018-11-22 05:40:24 |
| - | Rouge the Werebat X Tails - Commission.json | 13832 | 2018-11-19 14:11:46 |
| - | Rouge's Problem [Comm].json | 15475 | 2020-09-30 08:15:31 |
| - | Rouge's Problem [Comm][0].png | 279055 | 2020-09-30 08:15:29 |
| - | Rouge's Problem [Comm][1].png | 291806 | 2020-09-30 08:15:30 |
| - | Rouge's Problem [Comm][2].png | 265878 | 2020-09-30 08:15:31 |
| - | Rouge's Problem [Comm][3].png | 297151 | 2020-09-30 08:15:32 |
| - | Rouge's Trouble (?) 😅.gif | 9135633 | 2023-04-16 11:04:07 |
| - | Rouge's Trouble (?) 😅.json | 7464 | 2023-04-16 11:04:06 |
| - | Rouge’s Sexy Service 💞.json | 15728 | 2022-10-12 10:55:36 |
| - | Rouge’s Sexy Service 💞[0].png | 932460 | 2022-10-12 10:55:36 |
| - | Rouge’s Sexy Service 💞[1].png | 920205 | 2022-10-12 10:55:36 |
| - | Rouge’s Sexy Service 💞[2].png | 930118 | 2022-10-12 10:55:36 |
| - | Rouge’s Sexy Service 💞[3].png | 1049892 | 2022-10-12 10:55:37 |
| - | Roxanne [Comm].json | 12958 | 2020-07-30 17:01:01 |
| - | Roxanne [Comm][0].png | 534645 | 2020-07-30 17:00:59 |
| - | Roxanne [Comm][1].png | 544591 | 2020-07-30 17:01:01 |
| - | Roxanne [Comm][2].png | 476351 | 2020-07-30 17:01:02 |
| - | Ruto.json | 9152 | 2018-11-19 06:20:32 |
| - | Sadie (OC) - Polecat Mom.json | 9757 | 2024-06-05 10:10:53 |
| - | Sadie (OC) - Polecat Mom[0].png | 407810 | 2024-06-05 10:10:53 |
| - | Sadie (OC) - Polecat Mom[1].png | 347821 | 2024-06-05 10:10:53 |
| - | Saggita [Patreon Comm].json | 11548 | 2020-02-17 02:03:11 |
| - | Saggita [Patreon Comm][0].png | 914909 | 2020-02-17 02:03:11 |
| - | Saggita [Patreon Comm][1].png | 914401 | 2020-02-17 02:03:11 |
| - | Saika Katsumoto - Commission.json | 10789 | 2018-11-23 02:29:37 |
| - | Saika Katsumoto X Alice Sheepstar - Commission.json | 9248 | 2018-11-23 07:58:31 |
| - | Saika X Miyako [Comm].json | 8130 | 2018-11-23 15:20:30 |
| - | Saika X Miyako [Comm].png | 671696 | 2018-11-23 15:20:31 |
| - | Saki [Comm].json | 14225 | 2020-09-28 08:36:52 |
| - | Saki [Comm][0].png | 927818 | 2020-09-28 08:36:48 |
| - | Saki [Comm][1].png | 1494111 | 2020-09-28 08:36:50 |
| - | Saki [Comm][2].png | 895077 | 2020-09-28 08:36:52 |
| - | Saki [Comm][3].png | 1461425 | 2020-09-28 08:36:54 |
| - | Salazzle [Patreon Comm].json | 10990 | 2020-01-11 14:43:39 |
| - | Salazzle [Patreon Comm][0].png | 997261 | 2020-01-11 14:43:39 |
| - | Salazzle [Patreon Comm][1].png | 1075381 | 2020-01-11 14:43:40 |
| - | Sally X Fiona [Comm].json | 10292 | 2018-11-24 07:44:26 |
| - | Sally X Fiona [Comm][0].png | 478569 | 2018-11-24 07:44:26 |
| - | Sally X Fiona [Comm][1].png | 452978 | 2018-11-24 07:44:27 |
| - | Sash Lilac - Commission.json | 9989 | 2018-11-21 20:28:32 |
| - | Sasha X Frapter Bracllard [Patreon Comm].json | 10527 | 2020-01-11 14:31:41 |
| - | Sasha X Frapter Bracllard [Patreon Comm][0].png | 630249 | 2020-01-11 14:31:41 |
| - | Sasha X Frapter Bracllard [Patreon Comm][1].png | 738065 | 2020-01-11 14:31:41 |
| - | Sayaka and Friends [Comm].json | 15619 | 2022-02-27 11:57:25 |
| - | Sayaka and Friends [Comm][0].png | 1176339 | 2022-02-27 11:57:24 |
| - | Sayaka and Friends [Comm][1].png | 1378054 | 2022-02-27 11:57:25 |
| - | Sayaka and Friends [Comm][2].png | 1048936 | 2022-02-27 11:57:25 |
| - | Sayaka and Friends [Comm][3].png | 1200038 | 2022-02-27 11:57:25 |
| - | Scormidna's Cake 💚.json | 9508 | 2023-08-20 11:14:53 |
| - | Scormidna's Cake 💚[0].png | 639136 | 2023-08-20 11:14:53 |
| - | Scormidna's Cake 💚[1].png | 731749 | 2023-08-20 11:14:53 |
| - | Secretary Chitin - OC [Patreon Comm].json | 10848 | 2020-05-13 02:43:14 |
| - | Secretary Chitin - OC [Patreon Comm][0].png | 1075846 | 2020-05-13 02:43:14 |
| - | Secretary Chitin - OC [Patreon Comm][1].png | 1008487 | 2020-05-13 02:43:14 |
| - | Serenity [Comm].json | 8797 | 2020-05-13 02:14:24 |
| - | Serenity [Comm][0].png | 904556 | 2020-05-13 02:14:24 |
| - | Serenity [Comm][1].png | 808999 | 2020-05-13 02:14:24 |
| - | Sexy Bird [Comm].json | 18257 | 2021-04-12 17:29:50 |
| - | Sexy Bird [Comm][0].png | 729249 | 2021-04-12 17:29:16 |
| - | Sexy Bird [Comm][1].png | 703001 | 2021-04-12 17:29:39 |
| - | Sexy Bird [Comm][2].png | 704941 | 2021-04-12 17:29:45 |
| - | Sexy Bird [Comm][3].png | 731266 | 2021-04-12 17:29:47 |
| - | Sexy Bird [Comm][4].png | 956303 | 2021-04-12 17:29:50 |
| - | Sexy Bird [Comm][5].png | 959370 | 2021-04-12 17:29:56 |
| - | Sexy Carmelita 🦊💦.json | 17064 | 2023-01-01 11:09:33 |
| - | Sexy Carmelita 🦊💦[0].png | 727269 | 2023-01-01 11:09:32 |
| - | Sexy Carmelita 🦊💦[1].png | 734944 | 2023-01-01 11:09:32 |
| - | Sexy Carmelita 🦊💦[2].png | 728866 | 2023-01-01 11:09:32 |
| - | Sexy Carmelita 🦊💦[3].png | 714166 | 2023-01-01 11:09:33 |
| - | Sexy Carmelita 🦊💦[4].png | 772516 | 2023-01-01 11:09:33 |
| - | Shade the Echidna - Commission.json | 7600 | 2018-11-19 15:17:20 |
| - | Sharpevoir [Comm].json | 17527 | 2021-02-16 03:01:08 |
| - | Sharpevoir [Comm][0].png | 525175 | 2021-02-16 03:01:01 |
| - | Sharpevoir [Comm][1].png | 604931 | 2021-02-16 03:01:03 |
| - | Sharpevoir [Comm][2].png | 622251 | 2021-02-16 03:01:05 |
| - | Sharpevoir [Comm][3].png | 531004 | 2021-02-16 03:01:07 |
| - | Sharpevoir [Comm][4].png | 610895 | 2021-02-16 03:01:08 |
| - | Sharpevoir [Comm][5].png | 627061 | 2021-02-16 03:01:10 |
| - | She has a BIG band [Comm].json | 21058 | 2022-04-20 10:21:10 |
| - | She has a BIG band [Comm][0].png | 464178 | 2022-04-20 10:21:09 |
| - | She has a BIG band [Comm][1].png | 514254 | 2022-04-20 10:21:10 |
| - | She has a BIG band [Comm][2].png | 488137 | 2022-04-20 10:21:10 |
| - | She has a BIG band [Comm][3].png | 541000 | 2022-04-20 10:21:10 |
| - | She has a BIG band [Comm][4].png | 404977 | 2022-04-20 10:21:10 |
| - | She has a BIG band [Comm][5].png | 432073 | 2022-04-20 10:21:10 |
| - | She has a BIG band [Comm][6].png | 398977 | 2022-04-20 10:21:10 |
| - | She has a BIG band [Comm][7].png | 496556 | 2022-04-20 10:21:11 |
| - | Sheep mom - AT.json | 7049 | 2018-11-22 15:33:06 |
| - | Shirina [Comm].json | 13959 | 2020-09-28 23:15:28 |
| - | Shirina [Comm][0].png | 508928 | 2020-09-28 23:15:27 |
| - | Shirina [Comm][1].png | 549567 | 2020-09-28 23:15:27 |
| - | Shirina [Comm][2].png | 526037 | 2020-09-28 23:15:28 |
| - | Shirina [Comm][3].png | 568190 | 2020-09-28 23:15:29 |
| - | Shizue~.json | 5257 | 2018-11-18 23:14:57 |
| - | Sketch Fanbox Poll 1.json | 7305 | 2020-09-08 18:18:26 |
| - | Sketch Fanbox Poll 1.png | 1847287 | 2020-09-08 18:18:32 |
| - | Skyla Flygon [Comm].json | 9300 | 2018-11-24 01:15:00 |
| - | Skyla Flygon [Comm][0].png | 543156 | 2018-11-24 01:15:00 |
| - | Skyla Flygon [Comm][1].png | 543531 | 2018-11-24 01:15:00 |
| - | Skyler [Character Sheet] - Commission.json | 14600 | 2018-11-22 08:57:38 |
| - | Solar Flare (OC).json | 11838 | 2024-06-05 10:10:38 |
| - | Solar Flare (OC)[0].png | 248521 | 2024-06-05 10:10:37 |
| - | Solar Flare (OC)[1].png | 269323 | 2024-06-05 10:10:38 |
| - | Solar Flare (OC)[2].png | 267101 | 2024-06-05 10:10:38 |
| - | Sonic X Krystal - Commission.json | 6789 | 2018-11-22 07:23:26 |
| - | Sonic X Zooey [Comm].json | 6875 | 2018-11-24 08:37:21 |
| - | Sonic X Zooey [Comm].png | 288097 | 2018-11-24 08:37:21 |
| - | Sonikko - Cow Suit [Patreon Comm].json | 11739 | 2020-01-11 14:32:12 |
| - | Sonikko - Cow Suit [Patreon Comm][0].png | 894367 | 2020-01-11 14:32:12 |
| - | Sonikko - Cow Suit [Patreon Comm][1].png | 982366 | 2020-01-11 14:32:13 |
| - | Sonikko - Maid [Patreon Comm].json | 8291 | 2019-04-14 01:06:46 |
| - | Sonikko - Maid [Patreon Comm].png | 840128 | 2019-04-14 01:06:46 |
| - | Sophie [Comm].json | 11560 | 2021-04-13 01:59:50 |
| - | Sophie [Comm][0].png | 576270 | 2021-04-13 01:59:50 |
| - | Sophie [Comm][1].png | 663006 | 2021-04-13 01:59:51 |
| - | Soundbyte - Soft Pillows [Comm].json | 11009 | 2020-11-24 07:21:26 |
| - | Soundbyte - Soft Pillows [Comm][0].png | 377076 | 2020-11-24 07:21:26 |
| - | Soundbyte - Soft Pillows [Comm][1].png | 390329 | 2020-11-24 07:21:29 |
| - | Staying UP all night! [Comm].json | 13064 | 2020-10-15 07:07:36 |
| - | Staying UP all night! [Comm][0].png | 640384 | 2020-10-15 07:07:35 |
| - | Staying UP all night! [Comm][1].png | 643836 | 2020-10-15 07:07:36 |
| - | Staying UP all night! [Comm][2].png | 647086 | 2020-10-15 07:07:37 |
| - | Sticking it in Sticks [Patreon Comm].json | 17577 | 2020-09-27 16:25:07 |
| - | Sticking it in Sticks [Patreon Comm][0].png | 857496 | 2020-09-27 16:24:58 |
| - | Sticking it in Sticks [Patreon Comm][1].png | 861428 | 2020-09-27 16:25:01 |
| - | Sticking it in Sticks [Patreon Comm][2].png | 867967 | 2020-09-27 16:25:03 |
| - | Sticking it in Sticks [Patreon Comm][3].png | 870882 | 2020-09-27 16:25:05 |
| - | Sticking it in Sticks [Patreon Comm][4].png | 865974 | 2020-09-27 16:25:07 |
| - | Sticking it in Sticks [Patreon Comm][5].png | 868864 | 2020-09-27 16:25:09 |
| - | Sticks the Badger - Commission.json | 18785 | 2018-11-22 16:11:16 |
| - | Sticks' Treat [Patreon Comm].json | 13453 | 2020-09-26 19:19:38 |
| - | Sticks' Treat [Patreon Comm][0].png | 835988 | 2020-09-26 19:19:36 |
| - | Sticks' Treat [Patreon Comm][1].png | 840867 | 2020-09-26 19:19:38 |
| - | Sticks' Treat [Patreon Comm][2].png | 848305 | 2020-09-26 19:19:40 |
| - | Stirring the cream 🐐🍑.gif | 646313 | 2023-01-01 11:18:47 |
| - | Stirring the cream 🐐🍑.json | 8580 | 2023-01-01 11:18:47 |
| - | Strawberry [Patreon Comm].json | 7948 | 2018-12-11 03:12:28 |
| - | Strawberry [Patreon Comm].png | 585165 | 2018-12-11 03:12:28 |
| - | Sunlight Carbuncle - Commission.json | 6997 | 2018-11-21 15:07:42 |
| - | Sunlight Carbuncle 2 - Commission.json | 10366 | 2018-11-21 21:24:40 |
| - | Susie Booty 🍑.json | 15092 | 2024-06-05 10:11:36 |
| - | Susie Booty 🍑[0].png | 2050865 | 2024-06-05 10:11:35 |
| - | Susie Booty 🍑[1].png | 2040447 | 2024-06-05 10:11:36 |
| - | Susie Booty 🍑[2].png | 2051218 | 2024-06-05 10:11:36 |
| - | Susie Booty 🍑[3].png | 2037708 | 2024-06-05 10:11:36 |
| - | Sweet Dreams 🌙💦.json | 13248 | 2024-01-03 11:18:59 |
| - | Sweet Dreams 🌙💦[0].png | 1572541 | 2024-01-03 11:18:58 |
| - | Sweet Dreams 🌙💦[1].png | 1594855 | 2024-01-03 11:18:59 |
| - | Sweet Dreams 🌙💦[2].png | 1540632 | 2024-01-03 11:18:59 |
| - | Sweet Dreams 🌙💦[3].png | 1578382 | 2024-01-03 11:18:59 |
| - | TXN [Comm].json | 8376 | 2018-12-20 03:11:45 |
| - | TXN [Comm].png | 894149 | 2018-12-20 03:11:45 |
| - | Tails X Spring the Rabbit [Comm].json | 10452 | 2018-11-23 11:44:18 |
| - | Tails X Spring the Rabbit [Comm][0].png | 681963 | 2018-11-23 11:44:18 |
| - | Tails X Spring the Rabbit [Comm][1].png | 690054 | 2018-11-23 11:44:18 |
| - | Takeshi - Character Sheet [Comm].json | 6766 | 2018-11-24 23:11:19 |
| - | Takeshi - Character Sheet [Comm].png | 433163 | 2018-11-24 23:11:19 |
| - | Takeshi X Lei-Yin [Comm].json | 10364 | 2018-11-24 23:21:27 |
| - | Takeshi X Lei-Yin [Comm][0].png | 386383 | 2018-11-24 23:21:27 |
| - | Takeshi X Lei-Yin [Comm][1].png | 391685 | 2018-11-24 23:21:27 |
| - | Taokaka 2 - Commission.json | 6352 | 2018-11-21 12:40:15 |
| - | Taokaka is hungry 🤤.json | 11443 | 2023-08-02 10:21:42 |
| - | Taokaka is hungry 🤤[0].png | 979249 | 2023-08-02 10:21:42 |
| - | Taokaka is hungry 🤤[1].png | 983857 | 2023-08-02 10:21:42 |
| - | Taokaka is hungry 🤤[2].png | 989400 | 2023-08-02 10:21:43 |
| - | Taokaka.json | 7818 | 2018-11-19 12:46:53 |
| - | Tasty Pavita 💦.json | 11848 | 2023-01-01 11:08:59 |
| - | Tasty Pavita 💦[0].png | 1026640 | 2023-01-01 11:08:59 |
| - | Tasty Pavita 💦[1].png | 1058287 | 2023-01-01 11:08:59 |
| - | Tasty Pavita 💦[2].png | 1129889 | 2023-01-01 11:08:59 |
| - | Tell me more! ❤️.json | 14589 | 2023-08-02 10:22:30 |
| - | Tell me more! ❤️[0].png | 877484 | 2023-08-02 10:22:29 |
| - | Tell me more! ❤️[1].png | 897247 | 2023-08-02 10:22:29 |
| - | Tell me more! ❤️[2].png | 927903 | 2023-08-02 10:22:30 |
| - | Tell me more! ❤️[3].png | 908748 | 2023-08-02 10:22:30 |
| - | Tell me more! ❤️[4].png | 939423 | 2023-08-02 10:22:30 |
| - | Tentacular! 🐙💦.json | 15581 | 2023-01-01 11:07:43 |
| - | Tentacular! 🐙💦[0].png | 463043 | 2023-01-01 11:07:42 |
| - | Tentacular! 🐙💦[1].png | 415042 | 2023-01-01 11:07:43 |
| - | Tentacular! 🐙💦[2].png | 428982 | 2023-01-01 11:07:43 |
| - | Tentacular! 🐙💦[3].png | 445646 | 2023-01-01 11:07:43 |
| - | Tersh 2 [Comm].json | 12702 | 2021-01-09 04:30:55 |
| - | Tersh 2 [Comm][0].png | 512200 | 2021-01-09 04:30:54 |
| - | Tersh 2 [Comm][1].png | 558609 | 2021-01-09 04:30:55 |
| - | Tersh 2 [Comm][2].png | 632321 | 2021-01-09 04:30:55 |
| - | The Bunny Hop [Comm].json | 8165 | 2022-05-04 10:09:55 |
| - | The Bunny Hop [Comm].png | 687938 | 2022-05-04 10:09:56 |
| - | The Milf Caresser [Comm].json | 13476 | 2020-09-30 07:23:49 |
| - | The Milf Caresser [Comm][0].png | 191943 | 2020-09-30 07:23:48 |
| - | The Milf Caresser [Comm][1].png | 190327 | 2020-09-30 07:23:49 |
| - | The Milf Caresser [Comm][2].png | 258251 | 2020-09-30 07:23:50 |
| - | The nurses will now see you~ 💉💦.json | 12491 | 2023-08-20 11:14:38 |
| - | The nurses will now see you~ 💉💦[0].png | 1567632 | 2023-08-20 11:14:38 |
| - | The nurses will now see you~ 💉💦[1].png | 1421049 | 2023-08-20 11:14:38 |
| - | The nurses will now see you~ 💉💦[2].png | 1269369 | 2023-08-20 11:14:38 |
| - | The pie is not ready yet 🥧.json | 13174 | 2022-10-12 10:56:33 |
| - | The pie is not ready yet 🥧[0].png | 682733 | 2022-10-12 10:56:33 |
| - | The pie is not ready yet 🥧[1].png | 595741 | 2022-10-12 10:56:33 |
| - | The pie is not ready yet 🥧[2].png | 650656 | 2022-10-12 10:56:33 |
| - | Thicc Mongoose Ass [Comm].json | 8842 | 2020-10-12 06:28:51 |
| - | Thicc Mongoose Ass [Comm].png | 414865 | 2020-10-12 06:28:52 |
| - | Thicc Mongoose Booty [Comm].json | 15637 | 2021-01-09 04:31:13 |
| - | Thicc Mongoose Booty [Comm][0].png | 585318 | 2021-01-09 04:31:12 |
| - | Thicc Mongoose Booty [Comm][1].png | 586274 | 2021-01-09 04:31:12 |
| - | Thicc Mongoose Booty [Comm][2].png | 585337 | 2021-01-09 04:31:13 |
| - | Thicc Mongoose Booty [Comm][3].png | 586292 | 2021-01-09 04:31:14 |
| - | Tiff - Little Green Fuck Machine - Commission.json | 6431 | 2018-11-22 03:59:40 |
| - | Tiffany (Cow Transform) [Comm].json | 9766 | 2018-11-23 21:36:29 |
| - | Tiffany (Cow Transform) [Comm][0].png | 725317 | 2018-11-23 21:36:29 |
| - | Tiffany (Cow Transform) [Comm][1].png | 751565 | 2018-11-23 21:36:29 |
| - | Tigress [Comm].json | 13430 | 2020-07-19 08:44:38 |
| - | Tigress [Comm][0].png | 507644 | 2020-07-19 08:44:35 |
| - | Tigress [Comm][1].png | 778737 | 2020-07-19 08:44:37 |
| - | Tigress [Comm][2].png | 492431 | 2020-07-19 08:44:38 |
| - | Tigress [Comm][3].png | 526348 | 2020-07-19 08:44:40 |
| - | Tikal's Ancient Ass [Comm].json | 8448 | 2020-09-26 19:01:39 |
| - | Tikal's Ancient Ass [Comm].png | 576186 | 2020-09-26 19:01:39 |
| - | Time to enjoy on the Island~ 😎🏝️.json | 21609 | 2020-09-26 20:02:54 |
| - | Time to enjoy on the Island~ 😎🏝️[0].png | 954322 | 2020-09-26 20:02:45 |
| - | Time to enjoy on the Island~ 😎🏝️[1].png | 1037238 | 2020-09-26 20:02:46 |
| - | Time to enjoy on the Island~ 😎🏝️[2].png | 958817 | 2020-09-26 20:02:48 |
| - | Time to enjoy on the Island~ 😎🏝️[3].png | 1041839 | 2020-09-26 20:02:49 |
| - | Time to enjoy on the Island~ 😎🏝️[4].png | 938589 | 2020-09-26 20:02:51 |
| - | Time to enjoy on the Island~ 😎🏝️[5].png | 1019004 | 2020-09-26 20:02:52 |
| - | Time to enjoy on the Island~ 😎🏝️[6].png | 950464 | 2020-09-26 20:02:54 |
| - | Time to enjoy on the Island~ 😎🏝️[7].png | 1032155 | 2020-09-26 20:02:56 |
| - | Tiny Kong - Commission.json | 6317 | 2018-11-21 14:40:15 |
| - | Tokage - Commission.json | 5451 | 2018-11-19 13:16:32 |
| - | Toni [Comm].json | 7182 | 2018-11-23 13:43:16 |
| - | Toni [Comm].png | 804225 | 2018-11-23 13:43:16 |
| - | Tori the Braxien [Character Sheet] - Commission.json | 18916 | 2018-11-22 11:14:13 |
| - | Toriel - Ready to Cook [Comm].json | 13672 | 2020-10-12 05:35:09 |
| - | Toriel - Ready to Cook [Comm][0].png | 206081 | 2020-10-12 05:35:08 |
| - | Toriel - Ready to Cook [Comm][1].png | 255161 | 2020-10-12 05:35:09 |
| - | Toriel - Ready to Cook [Comm][2].png | 254422 | 2020-10-12 05:35:10 |
| - | Toriel [Comm].json | 7814 | 2018-11-23 13:03:38 |
| - | Toriel [Comm].png | 634340 | 2018-11-23 13:03:38 |
| - | Toriel 💓👀💦 [Patreon Comm].json | 8401 | 2019-03-07 00:23:01 |
| - | Toriel 💓👀💦 [Patreon Comm].png | 748890 | 2019-03-07 00:23:02 |
| - | Toriel's Pie [Comm].json | 17444 | 2020-09-30 05:35:54 |
| - | Toriel's Pie [Comm][0].png | 478981 | 2020-09-30 05:35:44 |
| - | Toriel's Pie [Comm][1].png | 518357 | 2020-09-30 05:35:47 |
| - | Toriel's Pie [Comm][2].png | 513100 | 2020-09-30 05:35:50 |
| - | Toriel's Pie [Comm][3].png | 497224 | 2020-09-30 05:35:54 |
| - | Toriel's Pie [Comm][4].png | 498781 | 2020-09-30 05:35:57 |
| - | Toriel.json | 5180 | 2018-11-19 12:50:35 |
| - | Trick or Treat.json | 15977 | 2021-11-08 21:01:19 |
| - | Trick or Treat[0].png | 1215502 | 2021-11-08 21:01:19 |
| - | Trick or Treat[1].png | 1450720 | 2021-11-08 21:01:19 |
| - | Trick or Treat[2].png | 1224662 | 2021-11-08 21:01:19 |
| - | Trick or Treat[3].png | 1459203 | 2021-11-08 21:01:19 |
| - | Trinity 2 [Comm].json | 14498 | 2022-02-27 11:57:13 |
| - | Trinity 2 [Comm][0].png | 845667 | 2022-02-27 11:57:13 |
| - | Trinity 2 [Comm][1].png | 1113726 | 2022-02-27 11:57:13 |
| - | Trinity 2 [Comm][2].png | 912766 | 2022-02-27 11:57:13 |
| - | Trinity 2 [Comm][3].png | 1124162 | 2022-02-27 11:57:14 |
| - | Trinity [Comm].json | 14433 | 2022-02-27 11:57:07 |
| - | Trinity [Comm][0].png | 602015 | 2022-02-27 11:57:07 |
| - | Trinity [Comm][1].png | 668012 | 2022-02-27 11:57:07 |
| - | Trinity [Comm][2].png | 686168 | 2022-02-27 11:57:07 |
| - | Trinity [Comm][3].png | 797459 | 2022-02-27 11:57:07 |
| - | Tristana needs support.json | 13172 | 2023-04-02 11:09:43 |
| - | Tristana needs support[0].png | 547469 | 2023-04-02 11:09:43 |
| - | Tristana needs support[1].png | 622879 | 2023-04-02 11:09:43 |
| - | Tristana needs support[2].png | 607106 | 2023-04-02 11:09:43 |
| - | Tristana needs support[3].png | 709810 | 2023-04-02 11:09:44 |
| - | Tsareena - Commission.json | 6352 | 2018-11-21 14:00:30 |
| - | Tsukino.json | 16107 | 2021-10-22 03:38:16 |
| - | Tsukino[0].png | 474659 | 2021-10-22 03:38:15 |
| - | Tsukino[1].png | 486897 | 2021-10-22 03:38:15 |
| - | Tsukino[2].png | 510253 | 2021-10-22 03:38:16 |
| - | Tsukino[3].png | 528368 | 2021-10-22 03:38:16 |
| - | Tsukino[4].png | 443680 | 2021-10-22 03:38:17 |
| - | Twice the Delight 👀💦.json | 9790 | 2024-06-05 10:08:58 |
| - | Twice the Delight 👀💦[0].png | 1381826 | 2024-06-05 10:08:58 |
| - | Twice the Delight 👀💦[1].png | 1416261 | 2024-06-05 10:08:59 |
| - | Twilight Sparkle 2.json | 8238 | 2018-11-18 21:41:48 |
| - | Twilight Sparkle.json | 5158 | 2018-11-19 01:53:15 |
| - | Umbra - Xmas [Comm].json | 10649 | 2021-01-09 04:31:00 |
| - | Umbra - Xmas [Comm][0].png | 738988 | 2021-01-09 04:31:00 |
| - | Umbra - Xmas [Comm][1].png | 749633 | 2021-01-09 04:31:01 |
| - | Umbra 4 - OC [Patreon Comm] (2_2).json | 11173 | 2020-05-13 02:39:01 |
| - | Umbra 4 - OC [Patreon Comm] (2_2)[0].png | 798899 | 2020-05-13 02:39:01 |
| - | Umbra 4 - OC [Patreon Comm] (2_2)[1].png | 936318 | 2020-05-13 02:39:02 |
| - | Umbra [Patreon Comm].json | 7694 | 2020-03-13 19:35:10 |
| - | Umbra [Patreon Comm].png | 655938 | 2020-03-13 19:35:11 |
| - | Uzume Firethorn [Comm].json | 14144 | 2022-05-11 10:09:29 |
| - | Uzume Firethorn [Comm][0].png | 623907 | 2022-05-11 10:09:28 |
| - | Uzume Firethorn [Comm][1].png | 582928 | 2022-05-11 10:09:28 |
| - | Uzume Firethorn [Comm][2].png | 587866 | 2022-05-11 10:09:29 |
| - | Uzume Firethorn [Comm][3].png | 662149 | 2022-05-11 10:09:29 |
| - | Valkyrie - Pheromosa [Comm].json | 11471 | 2020-01-12 06:02:11 |
| - | Valkyrie - Pheromosa [Comm][0].png | 723639 | 2020-01-12 06:02:11 |
| - | Valkyrie - Pheromosa [Comm][1].png | 767971 | 2020-01-12 06:02:12 |
| - | Vampi [ArtTrade].json | 7266 | 2019-02-01 05:08:55 |
| - | Vampi [ArtTrade].png | 649537 | 2019-02-01 05:08:55 |
| - | Vanilla X Cream - Commission.json | 12124 | 2018-11-22 07:54:42 |
| - | Vanilla the Rabbit - SM.json | 9345 | 2018-11-22 13:23:13 |
| - | Vanilla the Rabbit .json | 6857 | 2018-11-19 06:29:14 |
| - | Vanilla the Rabbit 2.json | 8375 | 2018-11-19 14:24:20 |
| - | Verona - Xmas [Comm].json | 8123 | 2021-01-09 04:31:02 |
| - | Verona - Xmas [Comm].png | 655117 | 2021-01-09 04:31:03 |
| - | Verona [Patreon Comm].json | 7277 | 2019-03-20 01:31:06 |
| - | Verona [Patreon Comm].png | 770737 | 2019-03-20 01:31:06 |
| - | Violet [Comm].json | 10955 | 2022-02-27 11:56:49 |
| - | Violet [Comm][0].png | 1058376 | 2022-02-27 11:56:49 |
| - | Violet [Comm][1].png | 1069326 | 2022-02-27 11:56:49 |
| - | Vivia [Patreon Comm].json | 10281 | 2020-01-11 16:22:58 |
| - | Vivia [Patreon Comm][0].png | 720411 | 2020-01-11 16:22:58 |
| - | Vivia [Patreon Comm][1].png | 650230 | 2020-01-11 16:22:58 |
| - | Wanna Race? [Comm].json | 12737 | 2021-01-09 04:31:07 |
| - | Wanna Race? [Comm][0].png | 505862 | 2021-01-09 04:31:06 |
| - | Wanna Race? [Comm][1].png | 538051 | 2021-01-09 04:31:07 |
| - | Wanna Race? [Comm][2].png | 491816 | 2021-01-09 04:31:08 |
| - | Wave X Rouge - Commission.json | 12261 | 2018-11-22 07:54:39 |
| - | Wave the Swallow.json | 8628 | 2018-11-19 15:08:03 |
| - | Weavile.json | 4628 | 2018-11-19 12:28:06 |
| - | Wendy O Koopa .json | 5234 | 2018-11-19 12:29:09 |
| - | Wendy O. Koopa - Monthly Fanart Poll N.4 (October).json | 8713 | 2018-11-24 15:14:03 |
| - | Wendy O. Koopa - Monthly Fanart Poll N.4 (October).png | 777888 | 2018-11-24 15:14:03 |
| - | Who!?.json | 21248 | 2020-06-18 18:03:51 |
| - | Who!?[0].png | 504754 | 2020-06-18 18:03:48 |
| - | Who!?[1].png | 520517 | 2020-06-18 18:03:48 |
| - | Who!?[2].png | 535139 | 2020-06-18 18:03:49 |
| - | Who!?[3].png | 548152 | 2020-06-18 18:03:49 |
| - | Who!?[4].png | 499394 | 2020-06-18 18:03:50 |
| - | Who!?[5].png | 512713 | 2020-06-18 18:03:50 |
| - | Who!?[6].png | 525286 | 2020-06-18 18:03:51 |
| - | Who!?[7].png | 536246 | 2020-06-18 18:03:51 |
| - | Whoa! Tawna!.json | 16083 | 2020-09-13 03:41:05 |
| - | Whoa! Tawna![0].png | 548539 | 2020-09-13 03:41:01 |
| - | Whoa! Tawna![1].png | 570480 | 2020-09-13 03:41:03 |
| - | Whoa! Tawna![2].png | 580850 | 2020-09-13 03:41:04 |
| - | Whoa! Tawna![3].png | 466966 | 2020-09-13 03:41:05 |
| - | Whoa! Tawna![4].png | 524981 | 2020-09-13 03:41:06 |
| - | With Aureli, size doesn't matter [Comm].json | 16863 | 2022-02-27 11:57:28 |
| - | With Aureli, size doesn't matter [Comm][0].png | 802130 | 2022-02-27 11:57:27 |
| - | With Aureli, size doesn't matter [Comm][1].png | 810555 | 2022-02-27 11:57:28 |
| - | With Aureli, size doesn't matter [Comm][2].png | 863547 | 2022-02-27 11:57:28 |
| - | With Aureli, size doesn't matter [Comm][3].png | 888181 | 2022-02-27 11:57:28 |
| - | With Aureli, size doesn't matter [Comm][4].png | 943678 | 2022-02-27 11:57:28 |
| - | Woomy ne! [Comm].json | 23972 | 2020-10-12 03:01:03 |
| - | Woomy ne! [Comm][0].png | 577296 | 2020-10-12 03:00:58 |
| - | Woomy ne! [Comm][1].png | 604064 | 2020-10-12 03:00:59 |
| - | Woomy ne! [Comm][2].png | 543376 | 2020-10-12 03:01:00 |
| - | Woomy ne! [Comm][3].png | 535484 | 2020-10-12 03:01:00 |
| - | Woomy ne! [Comm][4].png | 592662 | 2020-10-12 03:01:01 |
| - | Woomy ne! [Comm][5].png | 483969 | 2020-10-12 03:01:02 |
| - | Woomy ne! [Comm][6].png | 454511 | 2020-10-12 03:01:02 |
| - | Woomy ne! [Comm][7].png | 503235 | 2020-10-12 03:01:03 |
| - | Woomy ne! [Comm][8].png | 520766 | 2020-10-12 03:01:04 |
| - | Xyphyth [Comm].json | 10011 | 2018-11-24 02:37:10 |
| - | Xyphyth [Comm][0].png | 582388 | 2018-11-24 02:37:10 |
| - | Xyphyth [Comm][1].png | 599244 | 2018-11-24 02:37:10 |
| - | Yeah, Rouge, she's sexy and smooth.. 🎵.json | 14534 | 2024-06-05 10:11:48 |
| - | Yeah, Rouge, she's sexy and smooth.. 🎵[0].png | 2065389 | 2024-06-05 10:11:48 |
| - | Yeah, Rouge, she's sexy and smooth.. 🎵[1].png | 2090964 | 2024-06-05 10:11:48 |
| - | Yeah, Rouge, she's sexy and smooth.. 🎵[2].png | 2079747 | 2024-06-05 10:11:48 |
| - | Yoga Deerling [Comm].json | 10386 | 2019-02-12 01:16:32 |
| - | Yoga Deerling [Comm][0].png | 451476 | 2019-02-12 01:16:32 |
| - | Yoga Deerling [Comm][1].png | 445814 | 2019-02-12 01:16:32 |
| - | Yordle's Time~🍩 [Comm].json | 7973 | 2020-05-13 02:14:25 |
| - | Yordle's Time~🍩 [Comm].png | 839096 | 2020-05-13 02:14:25 |
| - | Zoey [Comm].json | 10811 | 2018-11-24 14:02:45 |
| - | Zoey [Comm][0].png | 1147066 | 2018-11-24 14:02:45 |
| - | Zoey [Comm][1].png | 471500 | 2018-11-24 14:02:46 |
| - | Zoroark - Bust Style [Patreon Comm].json | 17104 | 2020-09-26 05:33:36 |
| - | Zoroark - Bust Style [Patreon Comm][0].png | 606169 | 2020-09-26 05:33:11 |
| - | Zoroark - Bust Style [Patreon Comm][1].png | 626365 | 2020-09-26 05:33:16 |
| - | Zoroark - Bust Style [Patreon Comm][2].png | 681649 | 2020-09-26 05:33:33 |
| - | Zoroark - Bust Style [Patreon Comm][3].png | 608676 | 2020-09-26 05:33:36 |
| - | Zoroark - Bust Style [Patreon Comm][4].png | 636988 | 2020-09-26 05:33:39 |
!["Ta-daa!" ❤️[0].png](%22Ta-daa%21%22%20%E2%9D%A4%EF%B8%8F%5B0%5D.png?b=u){kind=link}
!["Ta-daa!" ❤️[1].png](%22Ta-daa%21%22%20%E2%9D%A4%EF%B8%8F%5B1%5D.png?b=u){kind=link}
!["Ta-daa!" ❤️[2].png](%22Ta-daa%21%22%20%E2%9D%A4%EF%B8%8F%5B2%5D.png?b=u){kind=link}
!["Today's the day I find that hero" ❤️[0].png](%22Today%27s%20the%20day%20I%20find%20that%20hero%22%20%E2%9D%A4%EF%B8%8F%5B0%5D.png?b=u){kind=link}
!["Today's the day I find that hero" ❤️[1].png](%22Today%27s%20the%20day%20I%20find%20that%20hero%22%20%E2%9D%A4%EF%B8%8F%5B1%5D.png?b=u){kind=link}
!["Today's the day I find that hero" ❤️[2].png](%22Today%27s%20the%20day%20I%20find%20that%20hero%22%20%E2%9D%A4%EF%B8%8F%5B2%5D.png?b=u){kind=link}
!["Today's the day I find that hero" ❤️[3].png](%22Today%27s%20the%20day%20I%20find%20that%20hero%22%20%E2%9D%A4%EF%B8%8F%5B3%5D.png?b=u){kind=link}
!["Today's the day I find that hero" ❤️[4].png](%22Today%27s%20the%20day%20I%20find%20that%20hero%22%20%E2%9D%A4%EF%B8%8F%5B4%5D.png?b=u){kind=link}
![3 Ponys [Comm][0].png](3%20Ponys%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![3 Ponys [Comm][1].png](3%20Ponys%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![A Big Royal Mummy Cat[0].png](A%20Big%20Royal%20Mummy%20Cat%5B0%5D.png?b=u){kind=link}
![A Big Royal Mummy Cat[1].png](A%20Big%20Royal%20Mummy%20Cat%5B1%5D.png?b=u){kind=link}
![A bit of quiet time~ 💛[0].png](A%20bit%20of%20quiet%20time~%20%F0%9F%92%9B%5B0%5D.png?b=u){kind=link}
![A bit of quiet time~ 💛[1].png](A%20bit%20of%20quiet%20time~%20%F0%9F%92%9B%5B1%5D.png?b=u){kind=link}
![A bit of quiet time~ 💛[2].png](A%20bit%20of%20quiet%20time~%20%F0%9F%92%9B%5B2%5D.png?b=u){kind=link}
![A mothers big surprise 💓[0].png](A%20mothers%20big%20surprise%20%F0%9F%92%93%5B0%5D.png?b=u){kind=link}
![A mothers big surprise 💓[1].png](A%20mothers%20big%20surprise%20%F0%9F%92%93%5B1%5D.png?b=u){kind=link}
![A mothers big surprise 💓[2].png](A%20mothers%20big%20surprise%20%F0%9F%92%93%5B2%5D.png?b=u){kind=link}
![A nice hug 🤗[0].png](A%20nice%20hug%20%F0%9F%A4%97%5B0%5D.png?b=u){kind=link}
![A nice hug 🤗[1].png](A%20nice%20hug%20%F0%9F%A4%97%5B1%5D.png?b=u){kind=link}
![A nice hug 🤗[2].png](A%20nice%20hug%20%F0%9F%A4%97%5B2%5D.png?b=u){kind=link}
![Abigail White [Comm].png](Abigail%20White%20%5BComm%5D.png?b=u){kind=link}
![Acaisha the Cat - OC [Comm].png](Acaisha%20the%20Cat%20-%20OC%20%5BComm%5D.png?b=u){kind=link}
![Akane [Comm].png](Akane%20%5BComm%5D.png?b=u){kind=link}
![Akeno Bee [Comm][0].png](Akeno%20Bee%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Akeno Bee [Comm][1].png](Akeno%20Bee%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Alice Renimpmon [Comm][0].png](Alice%20Renimpmon%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Alice Renimpmon [Comm][1].png](Alice%20Renimpmon%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Alice Sheepstar (Original) [Normal _ Futa Version][0].png](Alice%20Sheepstar%20%28Original%29%20%5BNormal%20_%20Futa%20Version%5D%5B0%5D.png?b=u){kind=link}
![Alice Sheepstar (Original) [Normal _ Futa Version][1].png](Alice%20Sheepstar%20%28Original%29%20%5BNormal%20_%20Futa%20Version%5D%5B1%5D.png?b=u){kind=link}
![Alice Sheepstar (Original) [Normal _ Futa Version][2].png](Alice%20Sheepstar%20%28Original%29%20%5BNormal%20_%20Futa%20Version%5D%5B2%5D.png?b=u){kind=link}
![Alice Sheepstar (Original) [Normal _ Futa Version][3].png](Alice%20Sheepstar%20%28Original%29%20%5BNormal%20_%20Futa%20Version%5D%5B3%5D.png?b=u){kind=link}
![Alice Sheepstar - Futanari, Love & Chocolate[0].png](Alice%20Sheepstar%20-%20Futanari%2C%20Love%20%26%20Chocolate%5B0%5D.png?b=u){kind=link}
![Alice Sheepstar - Futanari, Love & Chocolate[1].png](Alice%20Sheepstar%20-%20Futanari%2C%20Love%20%26%20Chocolate%5B1%5D.png?b=u){kind=link}
![Alice Sheepstar X Frapter Bracllard [Patreon Comm][0].png](Alice%20Sheepstar%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Alice Sheepstar X Frapter Bracllard [Patreon Comm][1].png](Alice%20Sheepstar%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Alice Sheepstar [Patreon Comm][0].png](Alice%20Sheepstar%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Alice Sheepstar [Patreon Comm][1].png](Alice%20Sheepstar%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Alisa'Tanguna - Character Sheet [Comm][0].png](Alisa%27Tanguna%20-%20Character%20Sheet%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Alisa'Tanguna - Character Sheet [Comm][1].png](Alisa%27Tanguna%20-%20Character%20Sheet%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Alphys secret experiment [Comm][0].png](Alphys%20secret%20experiment%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Alphys secret experiment [Comm][1].png](Alphys%20secret%20experiment%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Alphys secret experiment [Comm][2].png](Alphys%20secret%20experiment%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Alphys secret experiment [Comm][3].png](Alphys%20secret%20experiment%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Amiga😜💦🎶[0].png](Amiga%F0%9F%98%9C%F0%9F%92%A6%F0%9F%8E%B6%5B0%5D.png?b=u){kind=link}
![Amiga😜💦🎶[1].png](Amiga%F0%9F%98%9C%F0%9F%92%A6%F0%9F%8E%B6%5B1%5D.png?b=u){kind=link}
![Amiga😜💦🎶[2].png](Amiga%F0%9F%98%9C%F0%9F%92%A6%F0%9F%8E%B6%5B2%5D.png?b=u){kind=link}
![Amiga😜💦🎶[3].png](Amiga%F0%9F%98%9C%F0%9F%92%A6%F0%9F%8E%B6%5B3%5D.png?b=u){kind=link}
![Amiga😜💦🎶[4].png](Amiga%F0%9F%98%9C%F0%9F%92%A6%F0%9F%8E%B6%5B4%5D.png?b=u){kind=link}
![Amiga😜💦🎶[5].png](Amiga%F0%9F%98%9C%F0%9F%92%A6%F0%9F%8E%B6%5B5%5D.png?b=u){kind=link}
![Amy Has Something to Steal [Comm][0].png](Amy%20Has%20Something%20to%20Steal%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Amy Has Something to Steal [Comm][1].png](Amy%20Has%20Something%20to%20Steal%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Amy Has Something to Steal [Comm][2].png](Amy%20Has%20Something%20to%20Steal%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Amy Has Something to Steal [Comm][3].png](Amy%20Has%20Something%20to%20Steal%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Amy Has Something to Steal [Comm][4].png](Amy%20Has%20Something%20to%20Steal%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Amy Has Something to Steal [Comm][5].png](Amy%20Has%20Something%20to%20Steal%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Amy Rose 🌭 [Comm][0].png](Amy%20Rose%20%F0%9F%8C%AD%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Amy Rose 🌭 [Comm][1].png](Amy%20Rose%20%F0%9F%8C%AD%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Amy Rose 🌭 [Comm][2].png](Amy%20Rose%20%F0%9F%8C%AD%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Amy Rose 🌭 [Comm][3].png](Amy%20Rose%20%F0%9F%8C%AD%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Amy and Friends~ 🍆[Comm][0].png](Amy%20and%20Friends~%20%F0%9F%8D%86%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Amy and Friends~ 🍆[Comm][1].png](Amy%20and%20Friends~%20%F0%9F%8D%86%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Amy and Friends~ 🍆[Comm][2].png](Amy%20and%20Friends~%20%F0%9F%8D%86%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Amy's Growth Spurt 🍈🍈 [Comm].png](Amy%27s%20Growth%20Spurt%20%F0%9F%8D%88%F0%9F%8D%88%20%5BComm%5D.png?b=u){kind=link}
![Amy's Growth Spurt 🍈🍈 [Patreon Comm].png](Amy%27s%20Growth%20Spurt%20%F0%9F%8D%88%F0%9F%8D%88%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Amy's Protein Injection 😏🥛 [Patreon Comm][0].png](Amy%27s%20Protein%20Injection%20%F0%9F%98%8F%F0%9F%A5%9B%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Amy's Protein Injection 😏🥛 [Patreon Comm][1].png](Amy%27s%20Protein%20Injection%20%F0%9F%98%8F%F0%9F%A5%9B%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Ankhass [Comm].png](Ankhass%20%5BComm%5D.png?b=u){kind=link}
![Ann Maren (18+)[0].png](Ann%20Maren%20%2818%2B%29%5B0%5D.png?b=u){kind=link}
![Ann Maren (18+)[1].png](Ann%20Maren%20%2818%2B%29%5B1%5D.png?b=u){kind=link}
![Ann Maren (18+)[2].png](Ann%20Maren%20%2818%2B%29%5B2%5D.png?b=u){kind=link}
![Ann Maren (18+)[3].png](Ann%20Maren%20%2818%2B%29%5B3%5D.png?b=u){kind=link}
![Ann Maren (18+)[4].png](Ann%20Maren%20%2818%2B%29%5B4%5D.png?b=u){kind=link}
![Asayi - OC [Comm][0].png](Asayi%20-%20OC%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Asayi - OC [Comm][1].png](Asayi%20-%20OC%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Ashley - Pirate enforcer (Mermaid _ Salamander form) [Comm][0].png](Ashley%20-%20Pirate%20enforcer%20%28Mermaid%20_%20Salamander%20form%29%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Ashley - Pirate enforcer (Mermaid _ Salamander form) [Comm][1].png](Ashley%20-%20Pirate%20enforcer%20%28Mermaid%20_%20Salamander%20form%29%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Ass Hunter 😺[0].png](Ass%20Hunter%20%F0%9F%98%BA%5B0%5D.png?b=u){kind=link}
![Ass Hunter 😺[1].png](Ass%20Hunter%20%F0%9F%98%BA%5B1%5D.png?b=u){kind=link}
![Ava [Comm][0].png](Ava%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Ava [Comm][1].png](Ava%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Ayako Chives X Hui-Min [Comm][0].png](Ayako%20Chives%20X%20Hui-Min%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Ayako Chives X Hui-Min [Comm][1].png](Ayako%20Chives%20X%20Hui-Min%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Azure Aura 2 [Comm].png](Azure%20Aura%202%20%5BComm%5D.png?b=u){kind=link}
![Azure Aura [Comm].png](Azure%20Aura%20%5BComm%5D.png?b=u){kind=link}
![BIG Conductor's wife 💗[0].png](BIG%20Conductor%27s%20wife%20%F0%9F%92%97%5B0%5D.png?b=u){kind=link}
![BIG Conductor's wife 💗[1].png](BIG%20Conductor%27s%20wife%20%F0%9F%92%97%5B1%5D.png?b=u){kind=link}
![BIG Conductor's wife 💗[2].png](BIG%20Conductor%27s%20wife%20%F0%9F%92%97%5B2%5D.png?b=u){kind=link}
![BIG Dazzy 🫨💦[0].png](BIG%20Dazzy%20%F0%9F%AB%A8%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BIG Dazzy 🫨💦[1].png](BIG%20Dazzy%20%F0%9F%AB%A8%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BIG Double Battle 🫨💦[0].png](BIG%20Double%20Battle%20%F0%9F%AB%A8%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BIG Double Battle 🫨💦[1].png](BIG%20Double%20Battle%20%F0%9F%AB%A8%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BIG Double Battle 🫨💦[2].png](BIG%20Double%20Battle%20%F0%9F%AB%A8%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![BIG Feliciass (=ↀωↀ= )💦[0].png](BIG%20Feliciass%20%28%3D%E2%86%80%CF%89%E2%86%80%3D%20%29%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BIG Feliciass (=ↀωↀ= )💦[1].png](BIG%20Feliciass%20%28%3D%E2%86%80%CF%89%E2%86%80%3D%20%29%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BIG Feliciass (=ↀωↀ= )💦[2].png](BIG%20Feliciass%20%28%3D%E2%86%80%CF%89%E2%86%80%3D%20%29%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![BIG Fenneko 👀 💦[0].png](BIG%20Fenneko%20%F0%9F%91%80%20%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BIG Fenneko 👀 💦[1].png](BIG%20Fenneko%20%F0%9F%91%80%20%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BIG Fenneko 👀 💦[2].png](BIG%20Fenneko%20%F0%9F%91%80%20%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![BIG Happy Easter! 🐰🍑💦[0].png](BIG%20Happy%20Easter%21%20%F0%9F%90%B0%F0%9F%8D%91%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BIG Happy Easter! 🐰🍑💦[1].png](BIG%20Happy%20Easter%21%20%F0%9F%90%B0%F0%9F%8D%91%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BIG Happy Easter! 🐰🍑💦[2].png](BIG%20Happy%20Easter%21%20%F0%9F%90%B0%F0%9F%8D%91%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![BIG Hatterene 🫠[0].png](BIG%20Hatterene%20%F0%9F%AB%A0%5B0%5D.png?b=u){kind=link}
![BIG Hatterene 🫠[1].png](BIG%20Hatterene%20%F0%9F%AB%A0%5B1%5D.png?b=u){kind=link}
![BIG Hatterene 🫠[2].png](BIG%20Hatterene%20%F0%9F%AB%A0%5B2%5D.png?b=u){kind=link}
![BIG Isabelle🏝️[0].png](BIG%20Isabelle%F0%9F%8F%9D%EF%B8%8F%5B0%5D.png?b=u){kind=link}
![BIG Isabelle🏝️[1].png](BIG%20Isabelle%F0%9F%8F%9D%EF%B8%8F%5B1%5D.png?b=u){kind=link}
![BIG Isabelle🏝️[2].png](BIG%20Isabelle%F0%9F%8F%9D%EF%B8%8F%5B2%5D.png?b=u){kind=link}
![BIG Krystal 💖[0].png](BIG%20Krystal%20%F0%9F%92%96%5B0%5D.png?b=u){kind=link}
![BIG Krystal 💖[1].png](BIG%20Krystal%20%F0%9F%92%96%5B1%5D.png?b=u){kind=link}
![BIG Krystal 💖[2].png](BIG%20Krystal%20%F0%9F%92%96%5B2%5D.png?b=u){kind=link}
![BIG Lovander 💗[0].png](BIG%20Lovander%20%F0%9F%92%97%5B0%5D.png?b=u){kind=link}
![BIG Lovander 💗[1].png](BIG%20Lovander%20%F0%9F%92%97%5B1%5D.png?b=u){kind=link}
![BIG Lovander 💗[2].png](BIG%20Lovander%20%F0%9F%92%97%5B2%5D.png?b=u){kind=link}
![BIG Magic![0].png](BIG%20Magic%21%5B0%5D.png?b=u){kind=link}
![BIG Magic![1].png](BIG%20Magic%21%5B1%5D.png?b=u){kind=link}
![BIG Meow Skulls 🍑💦[0].png](BIG%20Meow%20Skulls%20%F0%9F%8D%91%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BIG Meow Skulls 🍑💦[1].png](BIG%20Meow%20Skulls%20%F0%9F%8D%91%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BIG Meow Skulls 🍑💦[2].png](BIG%20Meow%20Skulls%20%F0%9F%8D%91%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![BIG Pearl 🦑🍑💦[0].png](BIG%20Pearl%20%F0%9F%A6%91%F0%9F%8D%91%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BIG Pearl 🦑🍑💦[1].png](BIG%20Pearl%20%F0%9F%A6%91%F0%9F%8D%91%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BIG Pearl 🦑🍑💦[2].png](BIG%20Pearl%20%F0%9F%A6%91%F0%9F%8D%91%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![BIG Pearl 🦑🍑💦[3].png](BIG%20Pearl%20%F0%9F%A6%91%F0%9F%8D%91%F0%9F%92%A6%5B3%5D.png?b=u){kind=link}
![BIG Pearl 🦑🍑💦[4].png](BIG%20Pearl%20%F0%9F%A6%91%F0%9F%8D%91%F0%9F%92%A6%5B4%5D.png?b=u){kind=link}
![BIG Pearl 🦑🍑💦[5].png](BIG%20Pearl%20%F0%9F%A6%91%F0%9F%8D%91%F0%9F%92%A6%5B5%5D.png?b=u){kind=link}
![BIG Slushi 🍑💦[0].png](BIG%20Slushi%20%F0%9F%8D%91%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BIG Slushi 🍑💦[1].png](BIG%20Slushi%20%F0%9F%8D%91%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BIG Slushi 🍑💦[2].png](BIG%20Slushi%20%F0%9F%8D%91%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![BIG Tangle 💛💦 [Part 1][0].png](BIG%20Tangle%20%F0%9F%92%9B%F0%9F%92%A6%20%5BPart%201%5D%5B0%5D.png?b=u){kind=link}
![BIG Tangle 💛💦 [Part 1][1].png](BIG%20Tangle%20%F0%9F%92%9B%F0%9F%92%A6%20%5BPart%201%5D%5B1%5D.png?b=u){kind=link}
![BIG Tangle 💛💦 [Part 1][2].png](BIG%20Tangle%20%F0%9F%92%9B%F0%9F%92%A6%20%5BPart%201%5D%5B2%5D.png?b=u){kind=link}
![BIG Tangle 💛💦 [Part 2][0].png](BIG%20Tangle%20%F0%9F%92%9B%F0%9F%92%A6%20%5BPart%202%5D%5B0%5D.png?b=u){kind=link}
![BIG Tangle 💛💦 [Part 2][1].png](BIG%20Tangle%20%F0%9F%92%9B%F0%9F%92%A6%20%5BPart%202%5D%5B1%5D.png?b=u){kind=link}
![BIG Tangle 💛💦 [Part 2][2].png](BIG%20Tangle%20%F0%9F%92%9B%F0%9F%92%A6%20%5BPart%202%5D%5B2%5D.png?b=u){kind=link}
![BIG Toriel Beach Time! 💓🌴🌊[0].png](BIG%20Toriel%20Beach%20Time%21%20%F0%9F%92%93%F0%9F%8C%B4%F0%9F%8C%8A%5B0%5D.png?b=u){kind=link}
![BIG Toriel Beach Time! 💓🌴🌊[1].jpeg](BIG%20Toriel%20Beach%20Time%21%20%F0%9F%92%93%F0%9F%8C%B4%F0%9F%8C%8A%5B1%5D.jpeg?b=u){kind=link}
![BIG Toriel Beach Time! 💓🌴🌊[2].png](BIG%20Toriel%20Beach%20Time%21%20%F0%9F%92%93%F0%9F%8C%B4%F0%9F%8C%8A%5B2%5D.png?b=u){kind=link}
![BIG Vanilla X Conductor's wife - Valentine's 💞[0].png](BIG%20Vanilla%20X%20Conductor%27s%20wife%20-%20Valentine%27s%20%F0%9F%92%9E%5B0%5D.png?b=u){kind=link}
![BIG Vanilla X Conductor's wife - Valentine's 💞[1].png](BIG%20Vanilla%20X%20Conductor%27s%20wife%20-%20Valentine%27s%20%F0%9F%92%9E%5B1%5D.png?b=u){kind=link}
![BIG Vanilla X Conductor's wife - Valentine's 💞[2].png](BIG%20Vanilla%20X%20Conductor%27s%20wife%20-%20Valentine%27s%20%F0%9F%92%9E%5B2%5D.png?b=u){kind=link}
![BIG WumpASS Fruit (?) 🍑💦[0].png](BIG%20WumpASS%20Fruit%20%28%3F%29%20%F0%9F%8D%91%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BIG WumpASS Fruit (?) 🍑💦[1].png](BIG%20WumpASS%20Fruit%20%28%3F%29%20%F0%9F%8D%91%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BIG WumpASS Fruit (?) 🍑💦[2].png](BIG%20WumpASS%20Fruit%20%28%3F%29%20%F0%9F%8D%91%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![BIG Zhen 🐉💦[0].png](BIG%20Zhen%20%F0%9F%90%89%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BIG Zhen 🐉💦[1].png](BIG%20Zhen%20%F0%9F%90%89%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BIG Zhen 🐉💦[2].png](BIG%20Zhen%20%F0%9F%90%89%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![BIG bunny training 🥕🍑💦[0].png](BIG%20bunny%20training%20%F0%9F%A5%95%F0%9F%8D%91%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BIG bunny training 🥕🍑💦[1].png](BIG%20bunny%20training%20%F0%9F%A5%95%F0%9F%8D%91%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BIG bunny training 🥕🍑💦[2].png](BIG%20bunny%20training%20%F0%9F%A5%95%F0%9F%8D%91%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![BURU NYAASS~ 🍑💦[0].png](BURU%20NYAASS~%20%F0%9F%8D%91%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![BURU NYAASS~ 🍑💦[1].png](BURU%20NYAASS~%20%F0%9F%8D%91%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![BURU NYAASS~ 🍑💦[2].png](BURU%20NYAASS~%20%F0%9F%8D%91%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![BURU NYAASS~ 🍑💦[3].png](BURU%20NYAASS~%20%F0%9F%8D%91%F0%9F%92%A6%5B3%5D.png?b=u){kind=link}
![Bat 🆚 Rabbit[0].png](Bat%20%F0%9F%86%9A%20Rabbit%5B0%5D.png?b=u){kind=link}
![Bat 🆚 Rabbit[1].png](Bat%20%F0%9F%86%9A%20Rabbit%5B1%5D.png?b=u){kind=link}
![Bat 🆚 Rabbit[2].png](Bat%20%F0%9F%86%9A%20Rabbit%5B2%5D.png?b=u){kind=link}
![Bat 🆚 Rabbit[3].png](Bat%20%F0%9F%86%9A%20Rabbit%5B3%5D.png?b=u){kind=link}
![Baybay Gardevoir [Comm] 💓[0].png](Baybay%20Gardevoir%20%5BComm%5D%20%F0%9F%92%93%5B0%5D.png?b=u){kind=link}
![Baybay Gardevoir [Comm] 💓[1].png](Baybay%20Gardevoir%20%5BComm%5D%20%F0%9F%92%93%5B1%5D.png?b=u){kind=link}
![Baybay Gardevoir [Comm] 💓[2].png](Baybay%20Gardevoir%20%5BComm%5D%20%F0%9F%92%93%5B2%5D.png?b=u){kind=link}
![Baybay Gardevoir [Comm] 💓[3].png](Baybay%20Gardevoir%20%5BComm%5D%20%F0%9F%92%93%5B3%5D.png?b=u){kind=link}
![Be good, alright?[0].png](Be%20good%2C%20alright%3F%5B0%5D.png?b=u){kind=link}
![Be good, alright?[1].png](Be%20good%2C%20alright%3F%5B1%5D.png?b=u){kind=link}
![Beira (Sketch) [Comm].png](Beira%20%28Sketch%29%20%5BComm%5D.png?b=u){kind=link}
![Beira - Dakimakura [Comm].png](Beira%20-%20Dakimakura%20%5BComm%5D.png?b=u){kind=link}
![Beira Giant [Comm].png](Beira%20Giant%20%5BComm%5D.png?b=u){kind=link}
![Bellassnoir 🍑[0].png](Bellassnoir%20%F0%9F%8D%91%5B0%5D.png?b=u){kind=link}
![Bellassnoir 🍑[1].png](Bellassnoir%20%F0%9F%8D%91%5B1%5D.png?b=u){kind=link}
![Big Amy ❤️💦[Comm][0].png](Big%20Amy%20%E2%9D%A4%EF%B8%8F%F0%9F%92%A6%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Big Amy ❤️💦[Comm][1].png](Big%20Amy%20%E2%9D%A4%EF%B8%8F%F0%9F%92%A6%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Big Amy ❤️💦[Comm][2].png](Big%20Amy%20%E2%9D%A4%EF%B8%8F%F0%9F%92%A6%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Big Cream [Comm][0].png](Big%20Cream%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Big Cream [Comm][10].png](Big%20Cream%20%5BComm%5D%5B10%5D.png?b=u){kind=link}
![Big Cream [Comm][11].png](Big%20Cream%20%5BComm%5D%5B11%5D.png?b=u){kind=link}
![Big Cream [Comm][1].png](Big%20Cream%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Big Cream [Comm][2].png](Big%20Cream%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Big Cream [Comm][3].png](Big%20Cream%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Big Cream [Comm][4].png](Big%20Cream%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Big Cream [Comm][5].png](Big%20Cream%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Big Cream [Comm][6].png](Big%20Cream%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![Big Cream [Comm][7].png](Big%20Cream%20%5BComm%5D%5B7%5D.png?b=u){kind=link}
![Big Cream [Comm][8].png](Big%20Cream%20%5BComm%5D%5B8%5D.png?b=u){kind=link}
![Big Cream [Comm][9].png](Big%20Cream%20%5BComm%5D%5B9%5D.png?b=u){kind=link}
![Big Crossing - Part 1[0].png](Big%20Crossing%20-%20Part%201%5B0%5D.png?b=u){kind=link}
![Big Crossing - Part 1[1].png](Big%20Crossing%20-%20Part%201%5B1%5D.png?b=u){kind=link}
![Big Crossing - Part 1[2].png](Big%20Crossing%20-%20Part%201%5B2%5D.png?b=u){kind=link}
![Big Crossing - Part 1[3].png](Big%20Crossing%20-%20Part%201%5B3%5D.png?b=u){kind=link}
![Big Crossing - Part 2[0].png](Big%20Crossing%20-%20Part%202%5B0%5D.png?b=u){kind=link}
![Big Crossing - Part 2[1].png](Big%20Crossing%20-%20Part%202%5B1%5D.png?b=u){kind=link}
![Big Crossing - Part 2[2].png](Big%20Crossing%20-%20Part%202%5B2%5D.png?b=u){kind=link}
![Big Crossing - Part 2[3].png](Big%20Crossing%20-%20Part%202%5B3%5D.png?b=u){kind=link}
![Big Dog Princess 👑[0].png](Big%20Dog%20Princess%20%F0%9F%91%91%5B0%5D.png?b=u){kind=link}
![Big Dog Princess 👑[1].png](Big%20Dog%20Princess%20%F0%9F%91%91%5B1%5D.png?b=u){kind=link}
![Big Dog Princess 👑[2].png](Big%20Dog%20Princess%20%F0%9F%91%91%5B2%5D.png?b=u){kind=link}
![Big Emoji Alien ❤️[0].png](Big%20Emoji%20Alien%20%E2%9D%A4%EF%B8%8F%5B0%5D.png?b=u){kind=link}
![Big Emoji Alien ❤️[1].png](Big%20Emoji%20Alien%20%E2%9D%A4%EF%B8%8F%5B1%5D.png?b=u){kind=link}
![Big Emoji Alien ❤️[2].png](Big%20Emoji%20Alien%20%E2%9D%A4%EF%B8%8F%5B2%5D.png?b=u){kind=link}
![Big Emoji Alien ❤️[3].png](Big%20Emoji%20Alien%20%E2%9D%A4%EF%B8%8F%5B3%5D.png?b=u){kind=link}
![Big Fire 🔥(M)[0].png](Big%20Fire%20%F0%9F%94%A5%28M%29%5B0%5D.png?b=u){kind=link}
![Big Fire 🔥(M)[1].png](Big%20Fire%20%F0%9F%94%A5%28M%29%5B1%5D.png?b=u){kind=link}
![Big Gadget 🔧❤️💦[0].png](Big%20Gadget%20%F0%9F%94%A7%E2%9D%A4%EF%B8%8F%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Big Gadget 🔧❤️💦[1].png](Big%20Gadget%20%F0%9F%94%A7%E2%9D%A4%EF%B8%8F%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Big Gadget 🔧❤️💦[2].png](Big%20Gadget%20%F0%9F%94%A7%E2%9D%A4%EF%B8%8F%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![Big Gadget 🔧❤️💦[3].png](Big%20Gadget%20%F0%9F%94%A7%E2%9D%A4%EF%B8%8F%F0%9F%92%A6%5B3%5D.png?b=u){kind=link}
![Big Garnet 💓[0].png](Big%20Garnet%20%F0%9F%92%93%5B0%5D.png?b=u){kind=link}
![Big Garnet 💓[1].png](Big%20Garnet%20%F0%9F%92%93%5B1%5D.png?b=u){kind=link}
![Big Garnet 💓[2].png](Big%20Garnet%20%F0%9F%92%93%5B2%5D.png?b=u){kind=link}
![Big Genius Thumbeh 😉[0].png](Big%20Genius%20Thumbeh%20%F0%9F%98%89%5B0%5D.png?b=u){kind=link}
![Big Genius Thumbeh 😉[1].png](Big%20Genius%20Thumbeh%20%F0%9F%98%89%5B1%5D.png?b=u){kind=link}
![Big Genius Thumbeh 😉[2].png](Big%20Genius%20Thumbeh%20%F0%9F%98%89%5B2%5D.png?b=u){kind=link}
![Big Genius Thumbeh 😉[3].png](Big%20Genius%20Thumbeh%20%F0%9F%98%89%5B3%5D.png?b=u){kind=link}
![Big GrandCouncilwoman[0].png](Big%20GrandCouncilwoman%5B0%5D.png?b=u){kind=link}
![Big GrandCouncilwoman[1].png](Big%20GrandCouncilwoman%5B1%5D.png?b=u){kind=link}
![Big GrandCouncilwoman[2].png](Big%20GrandCouncilwoman%5B2%5D.png?b=u){kind=link}
![Big Hariet 🐰🌟[0].png](Big%20Hariet%20%F0%9F%90%B0%F0%9F%8C%9F%5B0%5D.png?b=u){kind=link}
![Big Hariet 🐰🌟[1].png](Big%20Hariet%20%F0%9F%90%B0%F0%9F%8C%9F%5B1%5D.png?b=u){kind=link}
![Big Hariet 🐰🌟[2].png](Big%20Hariet%20%F0%9F%90%B0%F0%9F%8C%9F%5B2%5D.png?b=u){kind=link}
![Big Jade[0].png](Big%20Jade%5B0%5D.png?b=u){kind=link}
![Big Jade[1].png](Big%20Jade%5B1%5D.png?b=u){kind=link}
![Big Jade[2].png](Big%20Jade%5B2%5D.png?b=u){kind=link}
![Big Jasmine (OC) 🍑[0].png](Big%20Jasmine%20%28OC%29%20%F0%9F%8D%91%5B0%5D.png?b=u){kind=link}
![Big Jasmine (OC) 🍑[1].png](Big%20Jasmine%20%28OC%29%20%F0%9F%8D%91%5B1%5D.png?b=u){kind=link}
![Big Jasmine (OC) 🍑[2].png](Big%20Jasmine%20%28OC%29%20%F0%9F%8D%91%5B2%5D.png?b=u){kind=link}
![Big Lavendula[0].png](Big%20Lavendula%5B0%5D.png?b=u){kind=link}
![Big Lavendula[1].png](Big%20Lavendula%5B1%5D.png?b=u){kind=link}
![Big Lavendula[2].png](Big%20Lavendula%5B2%5D.png?b=u){kind=link}
![Big Loona [Comm][0].png](Big%20Loona%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Big Loona [Comm][1].png](Big%20Loona%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Big Loona [Comm][2].png](Big%20Loona%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Big Maggie Pesky [Comm][0].png](Big%20Maggie%20Pesky%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Big Maggie Pesky [Comm][1].png](Big%20Maggie%20Pesky%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Big Mushrooms 🍄💦 [Comm][0].png](Big%20Mushrooms%20%F0%9F%8D%84%F0%9F%92%A6%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Big Mushrooms 🍄💦 [Comm][1].png](Big%20Mushrooms%20%F0%9F%8D%84%F0%9F%92%A6%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Big Mushrooms 🍄💦 [Comm][2].png](Big%20Mushrooms%20%F0%9F%8D%84%F0%9F%92%A6%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Big Mushrooms 🍄💦 [Comm][3].png](Big%20Mushrooms%20%F0%9F%8D%84%F0%9F%92%A6%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Big Nina [Comm][0].png](Big%20Nina%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Big Nina [Comm][1].png](Big%20Nina%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Big Sally[0].png](Big%20Sally%5B0%5D.png?b=u){kind=link}
![Big Sally[1].png](Big%20Sally%5B1%5D.png?b=u){kind=link}
![Big Sally[2].png](Big%20Sally%5B2%5D.png?b=u){kind=link}
![Big Spirit Balloon[0].png](Big%20Spirit%20Balloon%5B0%5D.png?b=u){kind=link}
![Big Spirit Balloon[1].png](Big%20Spirit%20Balloon%5B1%5D.png?b=u){kind=link}
![Big Surprise[0].png](Big%20Surprise%5B0%5D.png?b=u){kind=link}
![Big Surprise[1].png](Big%20Surprise%5B1%5D.png?b=u){kind=link}
![Big Surprise[2].png](Big%20Surprise%5B2%5D.png?b=u){kind=link}
![Big Surprise[3].png](Big%20Surprise%5B3%5D.png?b=u){kind=link}
![Big Tsukino[0].png](Big%20Tsukino%5B0%5D.png?b=u){kind=link}
![Big Tsukino[1].png](Big%20Tsukino%5B1%5D.png?b=u){kind=link}
![Big Tsukino[2].png](Big%20Tsukino%5B2%5D.png?b=u){kind=link}
![Big Tsukino[3].png](Big%20Tsukino%5B3%5D.png?b=u){kind=link}
![Big Tsukino[4].png](Big%20Tsukino%5B4%5D.png?b=u){kind=link}
![Big Tsukino[5].png](Big%20Tsukino%5B5%5D.png?b=u){kind=link}
![Big Tsukino[6].png](Big%20Tsukino%5B6%5D.png?b=u){kind=link}
![Big Vanny 🔦💦[0].png](Big%20Vanny%20%F0%9F%94%A6%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Big Vanny 🔦💦[1].png](Big%20Vanny%20%F0%9F%94%A6%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Big Vanny 🔦💦[2].png](Big%20Vanny%20%F0%9F%94%A6%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![Big Vanny 🔦💦[3].png](Big%20Vanny%20%F0%9F%94%A6%F0%9F%92%A6%5B3%5D.png?b=u){kind=link}
![Big Vex[0].png](Big%20Vex%5B0%5D.png?b=u){kind=link}
![Big Vex[1].png](Big%20Vex%5B1%5D.png?b=u){kind=link}
![Big Vex[2].png](Big%20Vex%5B2%5D.png?b=u){kind=link}
![Big Vex[3].png](Big%20Vex%5B3%5D.png?b=u){kind=link}
![Big Vex[4].png](Big%20Vex%5B4%5D.png?b=u){kind=link}
![Big Vex[5].png](Big%20Vex%5B5%5D.png?b=u){kind=link}
![Big Vex[6].png](Big%20Vex%5B6%5D.png?b=u){kind=link}
![Big Yaya [Comm].png](Big%20Yaya%20%5BComm%5D.png?b=u){kind=link}
![Big cute Loona 🐺💦[0].png](Big%20cute%20Loona%20%F0%9F%90%BA%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Big cute Loona 🐺💦[1].png](Big%20cute%20Loona%20%F0%9F%90%BA%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Big cute Loona 🐺💦[2].png](Big%20cute%20Loona%20%F0%9F%90%BA%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![Big technique[0].png](Big%20technique%5B0%5D.png?b=u){kind=link}
![Big technique[1].png](Big%20technique%5B1%5D.png?b=u){kind=link}
![Big technique[2].png](Big%20technique%5B2%5D.png?b=u){kind=link}
![Big technique[3].png](Big%20technique%5B3%5D.png?b=u){kind=link}
![Big technique[4].png](Big%20technique%5B4%5D.png?b=u){kind=link}
![Biggest Fan! 🌭💦[0].png](Biggest%20Fan%21%20%F0%9F%8C%AD%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Biggest Fan! 🌭💦[1].png](Biggest%20Fan%21%20%F0%9F%8C%AD%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Biggest Fan! 🌭💦[2].png](Biggest%20Fan%21%20%F0%9F%8C%AD%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![Bimbo Worshippin' [Comm][0].png](Bimbo%20Worshippin%27%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Bimbo Worshippin' [Comm][1].png](Bimbo%20Worshippin%27%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Bimbo Worshippin' [Comm][2].png](Bimbo%20Worshippin%27%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Bimbo Worshippin' [Comm][3].png](Bimbo%20Worshippin%27%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![BlASSiken 🐥🔥[0].png](BlASSiken%20%F0%9F%90%A5%F0%9F%94%A5%5B0%5D.png?b=u){kind=link}
![BlASSiken 🐥🔥[1].png](BlASSiken%20%F0%9F%90%A5%F0%9F%94%A5%5B1%5D.png?b=u){kind=link}
![BlASSiken 🐥🔥[2].png](BlASSiken%20%F0%9F%90%A5%F0%9F%94%A5%5B2%5D.png?b=u){kind=link}
![Blaze X Rouge - Slut Mania Plus[0].png](Blaze%20X%20Rouge%20-%20Slut%20Mania%20Plus%5B0%5D.png?b=u){kind=link}
![Blaze X Rouge - Slut Mania Plus[1].png](Blaze%20X%20Rouge%20-%20Slut%20Mania%20Plus%5B1%5D.png?b=u){kind=link}
![Blaze X Rouge [Patreon Comm][0].png](Blaze%20X%20Rouge%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Blaze X Rouge [Patreon Comm][1].png](Blaze%20X%20Rouge%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Blaze the BIG Cat 🍑💦[0].png](Blaze%20the%20BIG%20Cat%20%F0%9F%8D%91%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Blaze the BIG Cat 🍑💦[1].png](Blaze%20the%20BIG%20Cat%20%F0%9F%8D%91%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Blaze the BIG Cat 🍑💦[2].png](Blaze%20the%20BIG%20Cat%20%F0%9F%8D%91%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![Blaze's Vela Nova [Comm][0].png](Blaze%27s%20Vela%20Nova%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Blaze's Vela Nova [Comm][1].png](Blaze%27s%20Vela%20Nova%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Blaze's Vela Nova [Comm][2].png](Blaze%27s%20Vela%20Nova%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Blaze's Vela Nova [Comm][3].png](Blaze%27s%20Vela%20Nova%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Blaze's Vela Nova [Comm][4].png](Blaze%27s%20Vela%20Nova%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Blaze's Vela Nova [Comm][5].png](Blaze%27s%20Vela%20Nova%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Blaziken [Comm][0].png](Blaziken%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Blaziken [Comm][1].png](Blaziken%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Blaziken on fire [Comm][0].png](Blaziken%20on%20fire%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Blaziken on fire [Comm][1].png](Blaziken%20on%20fire%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Blaziken on fire [Comm][2].png](Blaziken%20on%20fire%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Blaziken on fire [Comm][3].png](Blaziken%20on%20fire%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Blue Bunnies Doing What They Do Best[0].png](Blue%20Bunnies%20Doing%20What%20They%20Do%20Best%5B0%5D.png?b=u){kind=link}
![Blue Bunnies Doing What They Do Best[1].png](Blue%20Bunnies%20Doing%20What%20They%20Do%20Best%5B1%5D.png?b=u){kind=link}
![Blue Bunnies Doing What They Do Best[2].png](Blue%20Bunnies%20Doing%20What%20They%20Do%20Best%5B2%5D.png?b=u){kind=link}
![Blue Bunnies Doing What They Do Best[3].png](Blue%20Bunnies%20Doing%20What%20They%20Do%20Best%5B3%5D.png?b=u){kind=link}
![Blue Bunnies Doing What They Do Best[4].png](Blue%20Bunnies%20Doing%20What%20They%20Do%20Best%5B4%5D.png?b=u){kind=link}
![Blue Bunnies Doing What They Do Best[5].png](Blue%20Bunnies%20Doing%20What%20They%20Do%20Best%5B5%5D.png?b=u){kind=link}
![Bountiful Bust[0].png](Bountiful%20Bust%5B0%5D.png?b=u){kind=link}
![Bountiful Bust[1].png](Bountiful%20Bust%5B1%5D.png?b=u){kind=link}
![Bunnie D'Coolette [Patreon Comm].png](Bunnie%20D%27Coolette%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Busty Galaxy Fighter Roomi 🌟[0].png](Busty%20Galaxy%20Fighter%20Roomi%20%F0%9F%8C%9F%5B0%5D.png?b=u){kind=link}
![Busty Galaxy Fighter Roomi 🌟[1].png](Busty%20Galaxy%20Fighter%20Roomi%20%F0%9F%8C%9F%5B1%5D.png?b=u){kind=link}
![Busty Galaxy Fighter Roomi 🌟[2].png](Busty%20Galaxy%20Fighter%20Roomi%20%F0%9F%8C%9F%5B2%5D.png?b=u){kind=link}
![Busty Galaxy Fighter Roomi 🌟[3].png](Busty%20Galaxy%20Fighter%20Roomi%20%F0%9F%8C%9F%5B3%5D.png?b=u){kind=link}
![Busty Galaxy Fighter Roomi 🌟[4].png](Busty%20Galaxy%20Fighter%20Roomi%20%F0%9F%8C%9F%5B4%5D.png?b=u){kind=link}
![Busty Galaxy Fighter Roomi 🌟[5].png](Busty%20Galaxy%20Fighter%20Roomi%20%F0%9F%8C%9F%5B5%5D.png?b=u){kind=link}
![Busty Galaxy Fighter Roomi 🌟[6].png](Busty%20Galaxy%20Fighter%20Roomi%20%F0%9F%8C%9F%5B6%5D.png?b=u){kind=link}
![Busty Galaxy Fighter Roomi 🌟[7].png](Busty%20Galaxy%20Fighter%20Roomi%20%F0%9F%8C%9F%5B7%5D.png?b=u){kind=link}
![COMMISSIONS [2018] - ROUND 2[0].png](COMMISSIONS%20%5B2018%5D%20-%20ROUND%202%5B0%5D.png?b=u){kind=link}
![COMMISSIONS [2018] - ROUND 2[1].png](COMMISSIONS%20%5B2018%5D%20-%20ROUND%202%5B1%5D.png?b=u){kind=link}
![COMMISSIONS [2018] - ROUND 2[5].png](COMMISSIONS%20%5B2018%5D%20-%20ROUND%202%5B5%5D.png?b=u){kind=link}
![COMMISSIONS [2018] - ROUND 2[6].png](COMMISSIONS%20%5B2018%5D%20-%20ROUND%202%5B6%5D.png?b=u){kind=link}
![COMMISSIONS [2018] - ROUND 3 (OPEN)[0].png](COMMISSIONS%20%5B2018%5D%20-%20ROUND%203%20%28OPEN%29%5B0%5D.png?b=u){kind=link}
![COMMISSIONS [2018] - ROUND 3 (OPEN)[1].png](COMMISSIONS%20%5B2018%5D%20-%20ROUND%203%20%28OPEN%29%5B1%5D.png?b=u){kind=link}
![COMMISSIONS [2018] - ROUND 3 (OPEN)[2].png](COMMISSIONS%20%5B2018%5D%20-%20ROUND%203%20%28OPEN%29%5B2%5D.png?b=u){kind=link}
![COMMISSIONS [2018] - ROUND 3 (OPEN)[3].png](COMMISSIONS%20%5B2018%5D%20-%20ROUND%203%20%28OPEN%29%5B3%5D.png?b=u){kind=link}
![COMMISSIONS [2019] (OPEN)[0].png](COMMISSIONS%20%5B2019%5D%20%28OPEN%29%5B0%5D.png?b=u){kind=link}
![COMMISSIONS [2019] (OPEN)[1].png](COMMISSIONS%20%5B2019%5D%20%28OPEN%29%5B1%5D.png?b=u){kind=link}
![COMMISSIONS [2019] (OPEN)[2].png](COMMISSIONS%20%5B2019%5D%20%28OPEN%29%5B2%5D.png?b=u){kind=link}
![COMMISSIONS [2019] (OPEN)[3].png](COMMISSIONS%20%5B2019%5D%20%28OPEN%29%5B3%5D.png?b=u){kind=link}
![COMMISSIONS [2021] (OPEN)[0].png](COMMISSIONS%20%5B2021%5D%20%28OPEN%29%5B0%5D.png?b=u){kind=link}
![COMMISSIONS [2021] (OPEN)[1].png](COMMISSIONS%20%5B2021%5D%20%28OPEN%29%5B1%5D.png?b=u){kind=link}
![COMMISSIONS [2021] (OPEN)[2].png](COMMISSIONS%20%5B2021%5D%20%28OPEN%29%5B2%5D.png?b=u){kind=link}
![COMMISSIONS [2021] (OPEN)[3].png](COMMISSIONS%20%5B2021%5D%20%28OPEN%29%5B3%5D.png?b=u){kind=link}
![COMMISSIONS [2021] (OPEN)[4].png](COMMISSIONS%20%5B2021%5D%20%28OPEN%29%5B4%5D.png?b=u){kind=link}
![COMMISSIONS [2022] (OPEN)[0].png](COMMISSIONS%20%5B2022%5D%20%28OPEN%29%5B0%5D.png?b=u){kind=link}
![COMMISSIONS [2022] (OPEN)[1].png](COMMISSIONS%20%5B2022%5D%20%28OPEN%29%5B1%5D.png?b=u){kind=link}
![COMMISSIONS [2022] (OPEN)[2].png](COMMISSIONS%20%5B2022%5D%20%28OPEN%29%5B2%5D.png?b=u){kind=link}
![COMMISSIONS [2022] (OPEN)[3].png](COMMISSIONS%20%5B2022%5D%20%28OPEN%29%5B3%5D.png?b=u){kind=link}
![Cabal - OC[0].png](Cabal%20-%20OC%5B0%5D.png?b=u){kind=link}
![Cabal - OC[1].png](Cabal%20-%20OC%5B1%5D.png?b=u){kind=link}
![Cabal - OC[2].png](Cabal%20-%20OC%5B2%5D.png?b=u){kind=link}
![Cain [Comm][0].png](Cain%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Cain [Comm][1].png](Cain%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Cain [Comm][2].png](Cain%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Calypso the Primarina [Comm][0].png](Calypso%20the%20Primarina%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Calypso the Primarina [Comm][1].png](Calypso%20the%20Primarina%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Captain Celaeno [Patreon Comm][0].png](Captain%20Celaeno%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Captain Celaeno [Patreon Comm][1].png](Captain%20Celaeno%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Catherine - Worgen stretching [Comm][0].png](Catherine%20-%20Worgen%20stretching%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Catherine - Worgen stretching [Comm][1].png](Catherine%20-%20Worgen%20stretching%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Catherine - Worgen stretching [Comm][2].png](Catherine%20-%20Worgen%20stretching%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Celeste Presenting [Comm][0].png](Celeste%20Presenting%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Celeste Presenting [Comm][1].png](Celeste%20Presenting%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Chao _ Flora X Bass [Comm][0].png](Chao%20_%20Flora%20X%20Bass%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Chao _ Flora X Bass [Comm][1].png](Chao%20_%20Flora%20X%20Bass%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Chao _ Flora X Bass [Comm][2].png](Chao%20_%20Flora%20X%20Bass%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Chao _ Flora X Bass [Comm][3].png](Chao%20_%20Flora%20X%20Bass%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Chao _ Flora X Bass [Comm][4].png](Chao%20_%20Flora%20X%20Bass%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Chao _ Flora X Bass [Comm][5].png](Chao%20_%20Flora%20X%20Bass%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Chao _ Flora X Bass [Comm][6].png](Chao%20_%20Flora%20X%20Bass%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![Chao _ Flora X Bass [Comm][7].png](Chao%20_%20Flora%20X%20Bass%20%5BComm%5D%5B7%5D.png?b=u){kind=link}
![Charlotte Butler - OC [Comm][0].png](Charlotte%20Butler%20-%20OC%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Charlotte Butler - OC [Comm][1].png](Charlotte%20Butler%20-%20OC%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Charlotte [Comm][0].png](Charlotte%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Charlotte [Comm][1].png](Charlotte%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Charlotte [Comm][2].png](Charlotte%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Charlotte [Comm][3].png](Charlotte%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Cheerleader of Victory ✌️[0].png](Cheerleader%20of%20Victory%20%E2%9C%8C%EF%B8%8F%5B0%5D.png?b=u){kind=link}
![Cheerleader of Victory ✌️[1].png](Cheerleader%20of%20Victory%20%E2%9C%8C%EF%B8%8F%5B1%5D.png?b=u){kind=link}
![Cheerleader of Victory ✌️[2].png](Cheerleader%20of%20Victory%20%E2%9C%8C%EF%B8%8F%5B2%5D.png?b=u){kind=link}
![Cherri Bomb [Comm][0].png](Cherri%20Bomb%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Cherri Bomb [Comm][1].png](Cherri%20Bomb%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Chibi - Fyra T Rose [Comm].png](Chibi%20-%20Fyra%20T%20Rose%20%5BComm%5D.png?b=u){kind=link}
![Chihara [Patreon Comm][0].png](Chihara%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Chihara [Patreon Comm][1].png](Chihara%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Chrysalis Time [Patreon Comm][0].png](Chrysalis%20Time%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Chrysalis Time [Patreon Comm][1].png](Chrysalis%20Time%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Cinderace [Comm][0].png](Cinderace%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Cinderace [Comm][1].png](Cinderace%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Cinderace [Comm][2].png](Cinderace%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Cinderace [Comm][3].png](Cinderace%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Cirli the Imp 🍩 [Comm].png](Cirli%20the%20Imp%20%F0%9F%8D%A9%20%5BComm%5D.png?b=u){kind=link}
![Classy Sally [Comm][0].png](Classy%20Sally%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Classy Sally [Comm][1].png](Classy%20Sally%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Classy Sally [Comm][2].png](Classy%20Sally%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Classy Sally [Comm][3].png](Classy%20Sally%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Classy Sally [Comm][4].png](Classy%20Sally%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Classy Sally [Comm][5].png](Classy%20Sally%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Clawroline - Un-Forgotten Land[0].png](Clawroline%20-%20Un-Forgotten%20Land%5B0%5D.png?b=u){kind=link}
![Clawroline - Un-Forgotten Land[1].png](Clawroline%20-%20Un-Forgotten%20Land%5B1%5D.png?b=u){kind=link}
![Clawroline - Un-Forgotten Land[2].png](Clawroline%20-%20Un-Forgotten%20Land%5B2%5D.png?b=u){kind=link}
![Clumsy Sunny [Comm][0].png](Clumsy%20Sunny%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Clumsy Sunny [Comm][1].png](Clumsy%20Sunny%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Coco - Bust Style [Comm][0].png](Coco%20-%20Bust%20Style%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Coco - Bust Style [Comm][1].png](Coco%20-%20Bust%20Style%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Coco - Bust Style [Comm][2].png](Coco%20-%20Bust%20Style%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Coco - Bust Style [Comm][3].png](Coco%20-%20Bust%20Style%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Coco - Bust Style [Comm][4].png](Coco%20-%20Bust%20Style%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Coco Bandicoot 🥥🥥👀💦[0].png](Coco%20Bandicoot%20%F0%9F%A5%A5%F0%9F%A5%A5%F0%9F%91%80%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Coco Bandicoot 🥥🥥👀💦[1].png](Coco%20Bandicoot%20%F0%9F%A5%A5%F0%9F%A5%A5%F0%9F%91%80%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Coco Bandicoot 🥥🥥👀💦[2].png](Coco%20Bandicoot%20%F0%9F%A5%A5%F0%9F%A5%A5%F0%9F%91%80%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![Coco Bandicoot 🥥🥥👀💦[3].png](Coco%20Bandicoot%20%F0%9F%A5%A5%F0%9F%A5%A5%F0%9F%91%80%F0%9F%92%A6%5B3%5D.png?b=u){kind=link}
![Coco Butticoot 🍑✨[0].gif](Coco%20Butticoot%20%F0%9F%8D%91%E2%9C%A8%5B0%5D.gif?b=u){kind=link}
![Coco Butticoot 🍑✨[1].gif](Coco%20Butticoot%20%F0%9F%8D%91%E2%9C%A8%5B1%5D.gif?b=u){kind=link}
![Coco X Coal [Comm][0].png](Coco%20X%20Coal%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Coco X Coal [Comm][1].png](Coco%20X%20Coal%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Coco X Coal [Comm][2].png](Coco%20X%20Coal%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Coco X Coal [Comm][3].png](Coco%20X%20Coal%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Coco X Coal [Comm][4].png](Coco%20X%20Coal%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Coco X Coal [Comm][5].png](Coco%20X%20Coal%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Coco X Coal [Comm][6].png](Coco%20X%20Coal%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![Coco X Coal [Comm][7].png](Coco%20X%20Coal%20%5BComm%5D%5B7%5D.png?b=u){kind=link}
![Coco's Cute[0].png](Coco%27s%20Cute%5B0%5D.png?b=u){kind=link}
![Coco's Cute[1].png](Coco%27s%20Cute%5B1%5D.png?b=u){kind=link}
![Coco's Cute[2].png](Coco%27s%20Cute%5B2%5D.png?b=u){kind=link}
![Coco's Cute[3].png](Coco%27s%20Cute%5B3%5D.png?b=u){kind=link}
![Coco's Cute[4].png](Coco%27s%20Cute%5B4%5D.png?b=u){kind=link}
![Coco's Cute[5].png](Coco%27s%20Cute%5B5%5D.png?b=u){kind=link}
![Coco's Cute[6].png](Coco%27s%20Cute%5B6%5D.png?b=u){kind=link}
![Coco's Cute[7].png](Coco%27s%20Cute%5B7%5D.png?b=u){kind=link}
![Comet [Patreon Comm][0].png](Comet%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Comet [Patreon Comm][1].png](Comet%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Commission Info and Prices [2023].png](Commission%20Info%20and%20Prices%20%5B2023%5D.png?b=u){kind=link}
![Cozmo - Too hot in here [Comm][0].png](Cozmo%20-%20Too%20hot%20in%20here%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Cozmo - Too hot in here [Comm][1].png](Cozmo%20-%20Too%20hot%20in%20here%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Cozmo - Too hot in here [Comm][2].png](Cozmo%20-%20Too%20hot%20in%20here%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Cream Filled Mongoose [Patreon Comm][0].png](Cream%20Filled%20Mongoose%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Cream Filled Mongoose [Patreon Comm][1].png](Cream%20Filled%20Mongoose%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Cream and Friends [Sketch][0].png](Cream%20and%20Friends%20%5BSketch%5D%5B0%5D.png?b=u){kind=link}
![Cream and Friends [Sketch][1].png](Cream%20and%20Friends%20%5BSketch%5D%5B1%5D.png?b=u){kind=link}
![Cream and Friends [Sketch][2].png](Cream%20and%20Friends%20%5BSketch%5D%5B2%5D.png?b=u){kind=link}
![Cream and Friends [Sketch][3].png](Cream%20and%20Friends%20%5BSketch%5D%5B3%5D.png?b=u){kind=link}
![Cream and Friends [Sketch][4].png](Cream%20and%20Friends%20%5BSketch%5D%5B4%5D.png?b=u){kind=link}
![Cream and Friends [Sketch][5].png](Cream%20and%20Friends%20%5BSketch%5D%5B5%5D.png?b=u){kind=link}
![Cream with Cream [Comm][0].png](Cream%20with%20Cream%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Cream with Cream [Comm][1].png](Cream%20with%20Cream%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Cream with Cream [Comm][2].png](Cream%20with%20Cream%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Cream with Cream [Comm][3].png](Cream%20with%20Cream%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Cream-White Fox Mom [Comm][0].png](Cream-White%20Fox%20Mom%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Cream-White Fox Mom [Comm][1].png](Cream-White%20Fox%20Mom%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Cream-White Fox Mom [Comm][2].png](Cream-White%20Fox%20Mom%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Cream-White Fox Mom [Comm][3].png](Cream-White%20Fox%20Mom%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Crissy - Gank Tanks[0].png](Crissy%20-%20Gank%20Tanks%5B0%5D.png?b=u){kind=link}
![Crissy - Gank Tanks[1].png](Crissy%20-%20Gank%20Tanks%5B1%5D.png?b=u){kind=link}
![Crissy - Gank Tanks[2].png](Crissy%20-%20Gank%20Tanks%5B2%5D.png?b=u){kind=link}
![Cuddle Team Leader - Bust Style [Comm][0].png](Cuddle%20Team%20Leader%20-%20Bust%20Style%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Cuddle Team Leader - Bust Style [Comm][1].png](Cuddle%20Team%20Leader%20-%20Bust%20Style%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Cuddle Team Leader - Bust Style [Comm][2].png](Cuddle%20Team%20Leader%20-%20Bust%20Style%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Cuddle Team Leader - Bust Style [Comm][3].png](Cuddle%20Team%20Leader%20-%20Bust%20Style%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Cute Fire 🔥(F)[0].png](Cute%20Fire%20%F0%9F%94%A5%28F%29%5B0%5D.png?b=u){kind=link}
![Cute Fire 🔥(F)[1].png](Cute%20Fire%20%F0%9F%94%A5%28F%29%5B1%5D.png?b=u){kind=link}
![Cute Froppy[0].png](Cute%20Froppy%5B0%5D.png?b=u){kind=link}
![Cute Froppy[1].png](Cute%20Froppy%5B1%5D.png?b=u){kind=link}
![Cute Reindeer Sighting[0].png](Cute%20Reindeer%20Sighting%5B0%5D.png?b=u){kind=link}
![Cute Reindeer Sighting[1].png](Cute%20Reindeer%20Sighting%5B1%5D.png?b=u){kind=link}
![Deep CutE 🐙🦑🎶[0].png](Deep%20CutE%20%F0%9F%90%99%F0%9F%A6%91%F0%9F%8E%B6%5B0%5D.png?b=u){kind=link}
![Deep CutE 🐙🦑🎶[1].png](Deep%20CutE%20%F0%9F%90%99%F0%9F%A6%91%F0%9F%8E%B6%5B1%5D.png?b=u){kind=link}
![Deep CutE 🐙🦑🎶[2].png](Deep%20CutE%20%F0%9F%90%99%F0%9F%A6%91%F0%9F%8E%B6%5B2%5D.png?b=u){kind=link}
![Delphox - Bust Style [Patreon Comm][0].png](Delphox%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Delphox - Bust Style [Patreon Comm][1].png](Delphox%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Delphox - Bust Style [Patreon Comm][2].png](Delphox%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Delphox - Bust Style [Patreon Comm][3].png](Delphox%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Delphox - Bust Style [Patreon Comm][4].png](Delphox%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B4%5D.png?b=u){kind=link}
![Delphox - Bust Style [Patreon Comm][5].png](Delphox%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B5%5D.png?b=u){kind=link}
![Delphox - Bust Style [Patreon Comm][6].png](Delphox%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B6%5D.png?b=u){kind=link}
![Delphox - Bust Style [Patreon Comm][7].png](Delphox%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B7%5D.png?b=u){kind=link}
![Delphox - Bust Style [Patreon Comm][8].png](Delphox%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B8%5D.png?b=u){kind=link}
![Delphox - Bust Style [Patreon Comm][9].png](Delphox%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B9%5D.png?b=u){kind=link}
![Detected[0].png](Detected%5B0%5D.png?b=u){kind=link}
![Detected[1].png](Detected%5B1%5D.png?b=u){kind=link}
![Detected[2].png](Detected%5B2%5D.png?b=u){kind=link}
![Detected[3].png](Detected%5B3%5D.png?b=u){kind=link}
![Diabola Chiliham (OC) - Character Sheet [Comm][0].png](Diabola%20Chiliham%20%28OC%29%20-%20Character%20Sheet%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Diabola Chiliham (OC) - Character Sheet [Comm][1].png](Diabola%20Chiliham%20%28OC%29%20-%20Character%20Sheet%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Dixie Kong - Oooh Bananaa[0].png](Dixie%20Kong%20-%20Oooh%20Bananaa%5B0%5D.png?b=u){kind=link}
![Dixie Kong - Oooh Bananaa[1].png](Dixie%20Kong%20-%20Oooh%20Bananaa%5B1%5D.png?b=u){kind=link}
![Dixie Kong - Oooh Bananaa[2].png](Dixie%20Kong%20-%20Oooh%20Bananaa%5B2%5D.png?b=u){kind=link}
![Do you have some eggs?[0].png](Do%20you%20have%20some%20eggs%3F%5B0%5D.png?b=u){kind=link}
![Do you have some eggs?[1].png](Do%20you%20have%20some%20eggs%3F%5B1%5D.png?b=u){kind=link}
![Do you have some eggs?[2].png](Do%20you%20have%20some%20eggs%3F%5B2%5D.png?b=u){kind=link}
![Don't Feed the Pandas [Comm][0].png](Don%27t%20Feed%20the%20Pandas%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Don't Feed the Pandas [Comm][1].png](Don%27t%20Feed%20the%20Pandas%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Don't Feed the Pandas [Comm][2].png](Don%27t%20Feed%20the%20Pandas%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Don't Feed the Pandas [Comm][3].png](Don%27t%20Feed%20the%20Pandas%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Don't Feed the Pandas [Comm][4].png](Don%27t%20Feed%20the%20Pandas%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Don't Feed the Pandas [Comm][5].png](Don%27t%20Feed%20the%20Pandas%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Dr. Voir [Comm][0].png](Dr.%20Voir%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Dr. Voir [Comm][1].png](Dr.%20Voir%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Dr. Voir [Comm][2].png](Dr.%20Voir%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Dr. Voir [Comm][3].png](Dr.%20Voir%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Dragonite [Patreon Comm][0].png](Dragonite%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Dragonite [Patreon Comm][1].png](Dragonite%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Dragonite [Patreon Comm][2].png](Dragonite%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Dragonite [Patreon Comm][3].png](Dragonite%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Elizabeth's Reward [Patreon Comm][0].png](Elizabeth%27s%20Reward%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Elizabeth's Reward [Patreon Comm][1].png](Elizabeth%27s%20Reward%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Elizabeth's Reward [Patreon Comm][2].png](Elizabeth%27s%20Reward%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Elizabeth's Reward [Patreon Comm][3].png](Elizabeth%27s%20Reward%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Erie - "Flame" Charge [Comm][0].png](Erie%20-%20%22Flame%22%20Charge%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Erie - "Flame" Charge [Comm][1].png](Erie%20-%20%22Flame%22%20Charge%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Erie - "Flame" Charge [Comm][2].png](Erie%20-%20%22Flame%22%20Charge%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Erie - "Flame" Charge [Comm][3].png](Erie%20-%20%22Flame%22%20Charge%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Erie - "Flame" Charge [Comm][4].png](Erie%20-%20%22Flame%22%20Charge%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Fate Valentine [Comm].png](Fate%20Valentine%20%5BComm%5D.png?b=u){kind=link}
![Felicia - OC [Comm][0].png](Felicia%20-%20OC%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Felicia - OC [Comm][1].png](Felicia%20-%20OC%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Felicia - OC [Comm][2].png](Felicia%20-%20OC%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Felicia - OC [Comm][3].png](Felicia%20-%20OC%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Felicia - OC [Comm][4].png](Felicia%20-%20OC%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Felicia - OC [Comm][5].png](Felicia%20-%20OC%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Fibell Luxbell[0].png](Fibell%20Luxbell%5B0%5D.png?b=u){kind=link}
![Fibell Luxbell[1].png](Fibell%20Luxbell%5B1%5D.png?b=u){kind=link}
![Fibell Luxbell[2].png](Fibell%20Luxbell%5B2%5D.png?b=u){kind=link}
![Fibell Luxbell[3].png](Fibell%20Luxbell%5B3%5D.png?b=u){kind=link}
![Fibell Luxbell[4].png](Fibell%20Luxbell%5B4%5D.png?b=u){kind=link}
![Fiera 2 [Patreon Comm].png](Fiera%202%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Fiera 3 [Patreon Comm].png](Fiera%203%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Fiera [Patreon Comm].png](Fiera%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Fiona - Bribing the authorities [Patreon Comm][0].png](Fiona%20-%20Bribing%20the%20authorities%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Fiona - Bribing the authorities [Patreon Comm][1].png](Fiona%20-%20Bribing%20the%20authorities%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Fiona Fox ❤️ [Patreon Comm].png](Fiona%20Fox%20%E2%9D%A4%EF%B8%8F%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Fiona's Funbags 🍈🍈 [Comm][0].png](Fiona%27s%20Funbags%20%F0%9F%8D%88%F0%9F%8D%88%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Fiona's Funbags 🍈🍈 [Comm][1].png](Fiona%27s%20Funbags%20%F0%9F%8D%88%F0%9F%8D%88%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Fiona's Funbags 🍈🍈 [Patreon Comm][0].png](Fiona%27s%20Funbags%20%F0%9F%8D%88%F0%9F%8D%88%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Francine Yagami X JY [Comm][0].png](Francine%20Yagami%20X%20JY%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Francine Yagami X JY [Comm][1].png](Francine%20Yagami%20X%20JY%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Francine Yagami X JY [Comm][2].png](Francine%20Yagami%20X%20JY%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Gal in charge[0].png](Gal%20in%20charge%5B0%5D.png?b=u){kind=link}
![Gal in charge[1].png](Gal%20in%20charge%5B1%5D.png?b=u){kind=link}
![Gal in charge[2].png](Gal%20in%20charge%5B2%5D.png?b=u){kind=link}
![Gardevoir [Patreon Comm][0].png](Gardevoir%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Gardevoir [Patreon Comm][1].png](Gardevoir%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Gauss - OC [Comm][0].png](Gauss%20-%20OC%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Gauss - OC [Comm][1].png](Gauss%20-%20OC%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Getting Fit with Amy 👀💦 [Comm][0].png](Getting%20Fit%20with%20Amy%20%F0%9F%91%80%F0%9F%92%A6%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Getting Fit with Amy 👀💦 [Comm][1].png](Getting%20Fit%20with%20Amy%20%F0%9F%91%80%F0%9F%92%A6%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Getting Fit with Amy 👀💦 [Comm][2].png](Getting%20Fit%20with%20Amy%20%F0%9F%91%80%F0%9F%92%A6%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Getting Fit with Amy 👀💦 [Comm][3].png](Getting%20Fit%20with%20Amy%20%F0%9F%91%80%F0%9F%92%A6%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Giratina [Patreon Comm].png](Giratina%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Gloria [Patreon Comm].png](Gloria%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Goodra 2 [Patreon Comm].png](Goodra%202%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Goodra 3 [Patreon Comm][0].png](Goodra%203%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Goodra 3 [Patreon Comm][1].png](Goodra%203%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Goodra 3 [Patreon Comm][2].png](Goodra%203%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Goodra 3 [Patreon Comm][3].png](Goodra%203%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Goodra [Patreon Comm][0].png](Goodra%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Goodra [Patreon Comm][1].png](Goodra%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Goodra [Patreon Comm][2].png](Goodra%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Goodra [Patreon Comm][3].png](Goodra%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Goth Gal’s Wardrobe Malfunction [Comm][0].png](Goth%20Gal%E2%80%99s%20Wardrobe%20Malfunction%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Goth Gal’s Wardrobe Malfunction [Comm][1].png](Goth%20Gal%E2%80%99s%20Wardrobe%20Malfunction%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Goth Gal’s Wardrobe Malfunction [Comm][2].png](Goth%20Gal%E2%80%99s%20Wardrobe%20Malfunction%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Goth Gal’s Wardrobe Malfunction [Comm][3].png](Goth%20Gal%E2%80%99s%20Wardrobe%20Malfunction%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Greninja [Patreon Comm].png](Greninja%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Hariet - SFP 2 (2021)[0].png](Hariet%20-%20SFP%202%20%282021%29%5B0%5D.png?b=u){kind=link}
![Hariet - SFP 2 (2021)[1].png](Hariet%20-%20SFP%202%20%282021%29%5B1%5D.png?b=u){kind=link}
![Hariet - SFP 2 (2021)[2].png](Hariet%20-%20SFP%202%20%282021%29%5B2%5D.png?b=u){kind=link}
![Hariet - SFP 2 (2021)[3].png](Hariet%20-%20SFP%202%20%282021%29%5B3%5D.png?b=u){kind=link}
![Have no fear! Amy Rose is here![0].png](Have%20no%20fear%21%20Amy%20Rose%20is%20here%21%5B0%5D.png?b=u){kind=link}
![Have no fear! Amy Rose is here![1].png](Have%20no%20fear%21%20Amy%20Rose%20is%20here%21%5B1%5D.png?b=u){kind=link}
![Have no fear! Amy Rose is here![2].png](Have%20no%20fear%21%20Amy%20Rose%20is%20here%21%5B2%5D.png?b=u){kind=link}
![Have no fear! Amy Rose is here![3].png](Have%20no%20fear%21%20Amy%20Rose%20is%20here%21%5B3%5D.png?b=u){kind=link}
![Have no fear! Amy Rose is here![4].png](Have%20no%20fear%21%20Amy%20Rose%20is%20here%21%5B4%5D.png?b=u){kind=link}
![Have no fear! Amy Rose is here![5].png](Have%20no%20fear%21%20Amy%20Rose%20is%20here%21%5B5%5D.png?b=u){kind=link}
![Have no fear! Amy Rose is here![6].png](Have%20no%20fear%21%20Amy%20Rose%20is%20here%21%5B6%5D.png?b=u){kind=link}
![Herm Rose X Tentacles [Patreon Comm].png](Herm%20Rose%20X%20Tentacles%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Hiko [Comm][0].png](Hiko%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Hiko [Comm][1].png](Hiko%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Hinata (OC) - Bust Style [Comm].png](Hinata%20%28OC%29%20-%20Bust%20Style%20%5BComm%5D.png?b=u){kind=link}
![Honey Steel - Pirate Captain [Comm].png](Honey%20Steel%20-%20Pirate%20Captain%20%5BComm%5D.png?b=u){kind=link}
![Horae Deerling [Comm].png](Horae%20Deerling%20%5BComm%5D.png?b=u){kind=link}
![Hot Protocol[0].png](Hot%20Protocol%5B0%5D.png?b=u){kind=link}
![Hot Protocol[1].png](Hot%20Protocol%5B1%5D.png?b=u){kind=link}
![Hui-Min - A Perfect View [Comm][0].png](Hui-Min%20-%20A%20Perfect%20View%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Hui-Min - A Perfect View [Comm][1].png](Hui-Min%20-%20A%20Perfect%20View%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Hui-Min Goes For a Ride [Comm][0].png](Hui-Min%20Goes%20For%20a%20Ride%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Hui-Min Goes For a Ride [Comm][1].png](Hui-Min%20Goes%20For%20a%20Ride%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Hui-Min X Frapter Bracllard [Comm][0].png](Hui-Min%20X%20Frapter%20Bracllard%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Hui-Min X Frapter Bracllard [Comm][1].png](Hui-Min%20X%20Frapter%20Bracllard%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Hui-Min X Penis [Comm][0].png](Hui-Min%20X%20Penis%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Hui-Min X Penis [Comm][1].png](Hui-Min%20X%20Penis%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Hui-Min X Penis [Comm][2].png](Hui-Min%20X%20Penis%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Hui-Min X Penis [Comm][3].png](Hui-Min%20X%20Penis%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Hui-Min [Patreon Comm].png](Hui-Min%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Hydreigon [Patreon Comm].png](Hydreigon%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![I know what you're looking for ❤️[0].png](I%20know%20what%20you%27re%20looking%20for%20%E2%9D%A4%EF%B8%8F%5B0%5D.png?b=u){kind=link}
![I know what you're looking for ❤️[1].png](I%20know%20what%20you%27re%20looking%20for%20%E2%9D%A4%EF%B8%8F%5B1%5D.png?b=u){kind=link}
![I know what you're looking for ❤️[2].png](I%20know%20what%20you%27re%20looking%20for%20%E2%9D%A4%EF%B8%8F%5B2%5D.png?b=u){kind=link}
![I'm inevitable [Comm][0].png](I%27m%20inevitable%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![I'm inevitable [Comm][1].png](I%27m%20inevitable%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![I'm inevitable [Comm][2].png](I%27m%20inevitable%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![I'm inevitable [Comm][3].png](I%27m%20inevitable%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Isabelle! 🍃[0].png](Isabelle%21%20%F0%9F%8D%83%5B0%5D.png?b=u){kind=link}
![Isabelle! 🍃[1].png](Isabelle%21%20%F0%9F%8D%83%5B1%5D.png?b=u){kind=link}
![Isabelle! 🍃[2].png](Isabelle%21%20%F0%9F%8D%83%5B2%5D.png?b=u){kind=link}
![Isamu Kaeru - Character Sheet [Comm].png](Isamu%20Kaeru%20-%20Character%20Sheet%20%5BComm%5D.png?b=u){kind=link}
![It's good to be out[0].png](It%27s%20good%20to%20be%20out%5B0%5D.png?b=u){kind=link}
![It's good to be out[1].png](It%27s%20good%20to%20be%20out%5B1%5D.png?b=u){kind=link}
![It's good to be out[2].png](It%27s%20good%20to%20be%20out%5B2%5D.png?b=u){kind=link}
![It's good to be out[3].png](It%27s%20good%20to%20be%20out%5B3%5D.png?b=u){kind=link}
![It's really hot here[0].png](It%27s%20really%20hot%20here%5B0%5D.png?b=u){kind=link}
![It's really hot here[1].png](It%27s%20really%20hot%20here%5B1%5D.png?b=u){kind=link}
![It's really hot here[2].png](It%27s%20really%20hot%20here%5B2%5D.png?b=u){kind=link}
![It's 🥥🥥 Time 👀💦[0].png](It%27s%20%F0%9F%A5%A5%F0%9F%A5%A5%20Time%20%F0%9F%91%80%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![It's 🥥🥥 Time 👀💦[1].png](It%27s%20%F0%9F%A5%A5%F0%9F%A5%A5%20Time%20%F0%9F%91%80%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![It's 🥥🥥 Time 👀💦[2].png](It%27s%20%F0%9F%A5%A5%F0%9F%A5%A5%20Time%20%F0%9F%91%80%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![It's 🥥🥥 Time 👀💦[3].png](It%27s%20%F0%9F%A5%A5%F0%9F%A5%A5%20Time%20%F0%9F%91%80%F0%9F%92%A6%5B3%5D.png?b=u){kind=link}
![Janice Lyall [Comm][0].png](Janice%20Lyall%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Janice Lyall [Comm][1].png](Janice%20Lyall%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Janice Lyall [Comm][2].png](Janice%20Lyall%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Janice Lyall [Comm][3].png](Janice%20Lyall%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Janice Lyall [Comm][4].png](Janice%20Lyall%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Janice Lyall [Comm][5].png](Janice%20Lyall%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Janice Lyall [Comm][6].png](Janice%20Lyall%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![Janice Lyall [Comm][7].png](Janice%20Lyall%20%5BComm%5D%5B7%5D.png?b=u){kind=link}
![Jasper [Comm][0].png](Jasper%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Jasper [Comm][1].png](Jasper%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Jenny's Prom Pickup! 💙[0].png](Jenny%27s%20Prom%20Pickup%21%20%F0%9F%92%99%5B0%5D.png?b=u){kind=link}
![Jenny's Prom Pickup! 💙[1].png](Jenny%27s%20Prom%20Pickup%21%20%F0%9F%92%99%5B1%5D.png?b=u){kind=link}
![Jewel X Frapter Bracllard [Patreon Comm][0].png](Jewel%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Jewel X Frapter Bracllard [Patreon Comm][1].png](Jewel%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Jewel X Frapter Bracllard [Patreon Comm][2].png](Jewel%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Jewel X Frapter Bracllard [Patreon Comm][3].png](Jewel%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Jonah - A Relaxing Pint [Comm].png](Jonah%20-%20A%20Relaxing%20Pint%20%5BComm%5D.png?b=u){kind=link}
![Justine [Comm].png](Justine%20%5BComm%5D.png?b=u){kind=link}
![Kally - Bust Style [Comm][0].png](Kally%20-%20Bust%20Style%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Kally - Bust Style [Comm][1].png](Kally%20-%20Bust%20Style%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Kally - Bust Style [Comm][2].png](Kally%20-%20Bust%20Style%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Kally - Bust Style [Comm][3].png](Kally%20-%20Bust%20Style%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Kally - Bust Style [Comm][4].png](Kally%20-%20Bust%20Style%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Kally - Bust Style [Comm][5].png](Kally%20-%20Bust%20Style%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Kalx Ink - OC [Comm][0].png](Kalx%20Ink%20-%20OC%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Kalx Ink - OC [Comm][1].png](Kalx%20Ink%20-%20OC%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Kalx Ink - OC [Comm][2].png](Kalx%20Ink%20-%20OC%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Kalx Ink - OC [Comm][3].png](Kalx%20Ink%20-%20OC%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Kalx Ink - OC [Comm][4].png](Kalx%20Ink%20-%20OC%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Kalx Ink - OC [Comm][5].png](Kalx%20Ink%20-%20OC%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Kanani - Beach Bikini Slip [Comm][0].png](Kanani%20-%20Beach%20Bikini%20Slip%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Kanani - Beach Bikini Slip [Comm][1].png](Kanani%20-%20Beach%20Bikini%20Slip%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Kangaskhan [Patreon Comm].png](Kangaskhan%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Kanna Kamui [Comm].png](Kanna%20Kamui%20%5BComm%5D.png?b=u){kind=link}
![Kanna Master Zero🍈🍈🚿[0].png](Kanna%20Master%20Zero%F0%9F%8D%88%F0%9F%8D%88%F0%9F%9A%BF%5B0%5D.png?b=u){kind=link}
![Kanna Master Zero🍈🍈🚿[1].png](Kanna%20Master%20Zero%F0%9F%8D%88%F0%9F%8D%88%F0%9F%9A%BF%5B1%5D.png?b=u){kind=link}
![Kanna Master Zero🍈🍈🚿[2].png](Kanna%20Master%20Zero%F0%9F%8D%88%F0%9F%8D%88%F0%9F%9A%BF%5B2%5D.png?b=u){kind=link}
![Kanna Master Zero🍈🍈🚿[3].png](Kanna%20Master%20Zero%F0%9F%8D%88%F0%9F%8D%88%F0%9F%9A%BF%5B3%5D.png?b=u){kind=link}
![Kanna Master Zero🍈🍈🚿[4].png](Kanna%20Master%20Zero%F0%9F%8D%88%F0%9F%8D%88%F0%9F%9A%BF%5B4%5D.png?b=u){kind=link}
![Kanna Master Zero🍈🍈🚿[5].png](Kanna%20Master%20Zero%F0%9F%8D%88%F0%9F%8D%88%F0%9F%9A%BF%5B5%5D.png?b=u){kind=link}
![Kaori - OC [Comm][0].png](Kaori%20-%20OC%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Kaori - OC [Comm][1].png](Kaori%20-%20OC%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Kaori Fumokoshi [Comm][0].png](Kaori%20Fumokoshi%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Kaori Fumokoshi [Comm][1].png](Kaori%20Fumokoshi%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Karin Bigheart X Frapter [Patreon Comm][0].png](Karin%20Bigheart%20X%20Frapter%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Karin Bigheart X Frapter [Patreon Comm][1].png](Karin%20Bigheart%20X%20Frapter%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Karin Bigheart [Patreon Comm].png](Karin%20Bigheart%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Karin Bigheart! [Patreon Comm][0].png](Karin%20Bigheart%21%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Karin Bigheart! [Patreon Comm][1].png](Karin%20Bigheart%21%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Kenza [Patreon Comm].png](Kenza%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Kimi Yagami - Commission [Character Sheet].png](Kimi%20Yagami%20-%20Commission%20%5BCharacter%20Sheet%5D.png?b=u){kind=link}
![Kimi Yagami 2 - Commission[0].png](Kimi%20Yagami%202%20-%20Commission%5B0%5D.png?b=u){kind=link}
![Kimi Yagami 2 - Commission[1].png](Kimi%20Yagami%202%20-%20Commission%5B1%5D.png?b=u){kind=link}
![Kimi Yagami 2 - Commission[2].png](Kimi%20Yagami%202%20-%20Commission%5B2%5D.png?b=u){kind=link}
![Kimi Yagami 2 - Commission[3].png](Kimi%20Yagami%202%20-%20Commission%5B3%5D.png?b=u){kind=link}
![Kimi Yagami 2 - Commission[4].png](Kimi%20Yagami%202%20-%20Commission%5B4%5D.png?b=u){kind=link}
![Kirlia [ArtTrade][0].png](Kirlia%20%5BArtTrade%5D%5B0%5D.png?b=u){kind=link}
![Kirlia [ArtTrade][1].png](Kirlia%20%5BArtTrade%5D%5B1%5D.png?b=u){kind=link}
![Kirlia [ArtTrade][2].png](Kirlia%20%5BArtTrade%5D%5B2%5D.png?b=u){kind=link}
![Kirlia [ArtTrade][3].png](Kirlia%20%5BArtTrade%5D%5B3%5D.png?b=u){kind=link}
![Ko Busty Boxing: Round 2 🥊[0].png](Ko%20Busty%20Boxing%3A%20Round%202%20%F0%9F%A5%8A%5B0%5D.png?b=u){kind=link}
![Ko Busty Boxing: Round 2 🥊[1].png](Ko%20Busty%20Boxing%3A%20Round%202%20%F0%9F%A5%8A%5B1%5D.png?b=u){kind=link}
![Ko Busty Boxing: Round 2 🥊[2].png](Ko%20Busty%20Boxing%3A%20Round%202%20%F0%9F%A5%8A%5B2%5D.png?b=u){kind=link}
![Ko Busty Boxing: Round 2 🥊[3].png](Ko%20Busty%20Boxing%3A%20Round%202%20%F0%9F%A5%8A%5B3%5D.png?b=u){kind=link}
![Kona (OC) [Comm][0].png](Kona%20%28OC%29%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Kona (OC) [Comm][1].png](Kona%20%28OC%29%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Kona (OC) [Comm][2].png](Kona%20%28OC%29%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Kona (OC) [Comm][3].png](Kona%20%28OC%29%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Krystal's "trouble" [Comm][0].png](Krystal%27s%20%22trouble%22%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Krystal's "trouble" [Comm][1].png](Krystal%27s%20%22trouble%22%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Krystal's "trouble" [Comm][2].png](Krystal%27s%20%22trouble%22%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Krystal's "trouble" [Comm][3].png](Krystal%27s%20%22trouble%22%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Krystal's "trouble" [Comm][4].png](Krystal%27s%20%22trouble%22%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Krystal's "trouble" [Comm][5].png](Krystal%27s%20%22trouble%22%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Krystal's "trouble" [Comm][6].png](Krystal%27s%20%22trouble%22%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![Krystal's "trouble" [Comm][7].png](Krystal%27s%20%22trouble%22%20%5BComm%5D%5B7%5D.png?b=u){kind=link}
![Lancelittle [Comm][0].png](Lancelittle%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Lancelittle [Comm][1].png](Lancelittle%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Lancelittle [Comm][2].png](Lancelittle%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Lanolin 🥛[0].png](Lanolin%20%F0%9F%A5%9B%5B0%5D.png?b=u){kind=link}
![Lanolin 🥛[1].png](Lanolin%20%F0%9F%A5%9B%5B1%5D.png?b=u){kind=link}
![Lanolin 🥛[2].png](Lanolin%20%F0%9F%A5%9B%5B2%5D.png?b=u){kind=link}
![Lanolin 🥛[3].png](Lanolin%20%F0%9F%A5%9B%5B3%5D.png?b=u){kind=link}
![Lei-Yin (OC) - Character Sheet [2024].png](Lei-Yin%20%28OC%29%20-%20Character%20Sheet%20%5B2024%5D.png?b=u){kind=link}
![Lei-Yin - Bust Style [Comm][0].png](Lei-Yin%20-%20Bust%20Style%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Lei-Yin - Bust Style [Comm][1].png](Lei-Yin%20-%20Bust%20Style%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Lei-Yin - Bust Style [Comm][2].png](Lei-Yin%20-%20Bust%20Style%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Lei-Yin - Bust Style [Comm][3].png](Lei-Yin%20-%20Bust%20Style%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Lei-Yin [Comm].png](Lei-Yin%20%5BComm%5D.png?b=u){kind=link}
![Lei-Yin's Booty [Patreon Comm].png](Lei-Yin%27s%20Booty%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Lei-Yin's Invitation [Comm][0].png](Lei-Yin%27s%20Invitation%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Lei-Yin's Invitation [Comm][1].png](Lei-Yin%27s%20Invitation%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Lei-Yin's Panda Booty 🐼💕 [Patreon Comm][0].png](Lei-Yin%27s%20Panda%20Booty%20%F0%9F%90%BC%F0%9F%92%95%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Lei-Yin's Panda Booty 🐼💕 [Patreon Comm][1].png](Lei-Yin%27s%20Panda%20Booty%20%F0%9F%90%BC%F0%9F%92%95%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Lei-Yin's Snack Time [Patreon Comm][0].png](Lei-Yin%27s%20Snack%20Time%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Lei-Yin's Snack Time [Patreon Comm][1].png](Lei-Yin%27s%20Snack%20Time%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Lei-Yin's Snack Time [Patreon Comm][2].png](Lei-Yin%27s%20Snack%20Time%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Lei-Yin's Snack Time [Patreon Comm][3].png](Lei-Yin%27s%20Snack%20Time%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Lesly Wolfess [Patreon Comm].png](Lesly%20Wolfess%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Let's do this~[0].png](Let%27s%20do%20this~%5B0%5D.png?b=u){kind=link}
![Let's do this~[1].png](Let%27s%20do%20this~%5B1%5D.png?b=u){kind=link}
![Let's do this~[2].png](Let%27s%20do%20this~%5B2%5D.png?b=u){kind=link}
![Lien-Da[0].png](Lien-Da%5B0%5D.png?b=u){kind=link}
![Lien-Da[1].png](Lien-Da%5B1%5D.png?b=u){kind=link}
![Lien-Da[2].png](Lien-Da%5B2%5D.png?b=u){kind=link}
![Lien-Da[3].png](Lien-Da%5B3%5D.png?b=u){kind=link}
![Lien-Da[4].png](Lien-Da%5B4%5D.png?b=u){kind=link}
![Lina (OC) [Comm][0].png](Lina%20%28OC%29%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Lina (OC) [Comm][1].png](Lina%20%28OC%29%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Lina the Ghoul - OC [Comm].png](Lina%20the%20Ghoul%20-%20OC%20%5BComm%5D.png?b=u){kind=link}
![Lina the Ghoul 😚 [Patreon Comm].png](Lina%20the%20Ghoul%20%F0%9F%98%9A%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][0].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][10].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B10%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][11].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B11%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][12].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B12%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][13].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B13%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][14].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B14%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][15].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B15%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][16].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B16%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][17].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B17%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][18].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B18%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][19].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B19%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][1].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][20].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B20%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][21].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B21%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][22].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B22%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][23].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B23%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][24].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B24%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][25].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B25%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][26].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B26%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][27].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B27%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][2].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][3].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][4].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][5].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][6].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][7].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B7%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][8].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B8%5D.png?b=u){kind=link}
![Little Carrot, Big Stuffing [Comm][9].png](Little%20Carrot%2C%20Big%20Stuffing%20%5BComm%5D%5B9%5D.png?b=u){kind=link}
![Little Kitty 🍃[0].png](Little%20Kitty%20%F0%9F%8D%83%5B0%5D.png?b=u){kind=link}
![Little Kitty 🍃[1].png](Little%20Kitty%20%F0%9F%8D%83%5B1%5D.png?b=u){kind=link}
![Little Kitty 🍃[2].png](Little%20Kitty%20%F0%9F%8D%83%5B2%5D.png?b=u){kind=link}
![Little Kitty 🍃[3].png](Little%20Kitty%20%F0%9F%8D%83%5B3%5D.png?b=u){kind=link}
![Little Kitty 🍃[4].png](Little%20Kitty%20%F0%9F%8D%83%5B4%5D.png?b=u){kind=link}
![Little Meg [Comm][0].png](Little%20Meg%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Little Meg [Comm][1].png](Little%20Meg%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Little Smile [Comm][0].png](Little%20Smile%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Little Smile [Comm][1].png](Little%20Smile%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Little Smile [Comm][2].png](Little%20Smile%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Little Smile [Comm][3].png](Little%20Smile%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Little Smile [Comm][4].png](Little%20Smile%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Lopa's Bunny Buns [Comm][0].png](Lopa%27s%20Bunny%20Buns%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Lopa's Bunny Buns [Comm][1].png](Lopa%27s%20Bunny%20Buns%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Lopa's Bunny Buns [Comm][2].png](Lopa%27s%20Bunny%20Buns%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Lopa's Bunny Buns [Comm][3].png](Lopa%27s%20Bunny%20Buns%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Lopa's Squishy Boobs! [Comm][0].png](Lopa%27s%20Squishy%20Boobs%21%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Lopa's Squishy Boobs! [Comm][1].png](Lopa%27s%20Squishy%20Boobs%21%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Lopa's Squishy Boobs! [Comm][2].png](Lopa%27s%20Squishy%20Boobs%21%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Lopa's Squishy Boobs! [Comm][3].png](Lopa%27s%20Squishy%20Boobs%21%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Loy Miyazaki X Hui-Min [Comm][0].png](Loy%20Miyazaki%20X%20Hui-Min%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Loy Miyazaki X Hui-Min [Comm][1].png](Loy%20Miyazaki%20X%20Hui-Min%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Loyal Servants[0].png](Loyal%20Servants%5B0%5D.png?b=u){kind=link}
![Loyal Servants[1].png](Loyal%20Servants%5B1%5D.png?b=u){kind=link}
![Loyal Servants[2].png](Loyal%20Servants%5B2%5D.png?b=u){kind=link}
![Loyal Servants[3].png](Loyal%20Servants%5B3%5D.png?b=u){kind=link}
![Ludovica [Patreon Comm].png](Ludovica%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Lugia 🥛 [Patreon Comm][0].png](Lugia%20%F0%9F%A5%9B%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Lugia 🥛 [Patreon Comm][1].png](Lugia%20%F0%9F%A5%9B%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Lulu's Cute [Comm][0].png](Lulu%27s%20Cute%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Lulu's Cute [Comm][1].png](Lulu%27s%20Cute%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Lulu's Cute [Comm][2].png](Lulu%27s%20Cute%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Lulu's Cute [Comm][3].png](Lulu%27s%20Cute%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Lulu's Cute [Comm][4].png](Lulu%27s%20Cute%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Lulu's Cute [Comm][5].png](Lulu%27s%20Cute%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Lulu's Cute [Comm][6].png](Lulu%27s%20Cute%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![Lulu's Cute [Comm][7].png](Lulu%27s%20Cute%20%5BComm%5D%5B7%5D.png?b=u){kind=link}
![Luvalind Blue 2 [Patreon Comm][0].png](Luvalind%20Blue%202%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Luvalind Blue 2 [Patreon Comm][1].png](Luvalind%20Blue%202%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Luvalind Blue [Patreon Comm][0].png](Luvalind%20Blue%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Luvalind Blue [Patreon Comm][1].png](Luvalind%20Blue%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![MY PATREON [MATOSPECTORU].png](MY%20PATREON%20%5BMATOSPECTORU%5D.png?b=u){kind=link}
![Mackenzie - Bashful beaver butt [Comm][0].png](Mackenzie%20-%20Bashful%20beaver%20butt%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Mackenzie - Bashful beaver butt [Comm][1].png](Mackenzie%20-%20Bashful%20beaver%20butt%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Mackenzie - Bashful beaver butt [Comm][2].png](Mackenzie%20-%20Bashful%20beaver%20butt%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Mackenzie - Bashful beaver butt [Comm][3].png](Mackenzie%20-%20Bashful%20beaver%20butt%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Mad Mew Mew[0].png](Mad%20Mew%20Mew%5B0%5D.png?b=u){kind=link}
![Mad Mew Mew[1].png](Mad%20Mew%20Mew%5B1%5D.png?b=u){kind=link}
![Mad Mew Mew[2].png](Mad%20Mew%20Mew%5B2%5D.png?b=u){kind=link}
![Mad Mew Mew[3].png](Mad%20Mew%20Mew%5B3%5D.png?b=u){kind=link}
![Mad Mew Mew[4].png](Mad%20Mew%20Mew%5B4%5D.png?b=u){kind=link}
![Mad Mew Mew[5].png](Mad%20Mew%20Mew%5B5%5D.png?b=u){kind=link}
![Magic Problems?[0].png](Magic%20Problems%3F%5B0%5D.png?b=u){kind=link}
![Magic Problems?[1].png](Magic%20Problems%3F%5B1%5D.png?b=u){kind=link}
![Magic Problems?[2].png](Magic%20Problems%3F%5B2%5D.png?b=u){kind=link}
![Maia Acheron[0].png](Maia%20Acheron%5B0%5D.png?b=u){kind=link}
![Maia Acheron[1].png](Maia%20Acheron%5B1%5D.png?b=u){kind=link}
![Maia Acheron[2].png](Maia%20Acheron%5B2%5D.png?b=u){kind=link}
![Maia Acheron[3].png](Maia%20Acheron%5B3%5D.png?b=u){kind=link}
![Mariah Tanning ☀️[Patreon Comm][0].png](Mariah%20Tanning%20%E2%98%80%EF%B8%8F%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Mariah Tanning ☀️[Patreon Comm][1].png](Mariah%20Tanning%20%E2%98%80%EF%B8%8F%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Mariah Tanning ☀️[Patreon Comm][2].png](Mariah%20Tanning%20%E2%98%80%EF%B8%8F%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Mariah Tanning ☀️[Patreon Comm][3].png](Mariah%20Tanning%20%E2%98%80%EF%B8%8F%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Mariah Tanning ☀️[Patreon Comm][4].png](Mariah%20Tanning%20%E2%98%80%EF%B8%8F%5BPatreon%20Comm%5D%5B4%5D.png?b=u){kind=link}
![Mariah Tanning ☀️[Patreon Comm][5].png](Mariah%20Tanning%20%E2%98%80%EF%B8%8F%5BPatreon%20Comm%5D%5B5%5D.png?b=u){kind=link}
![Mariah Tanning ☀️[Patreon Comm][6].png](Mariah%20Tanning%20%E2%98%80%EF%B8%8F%5BPatreon%20Comm%5D%5B6%5D.png?b=u){kind=link}
![Mariah Tanning ☀️[Patreon Comm][7].png](Mariah%20Tanning%20%E2%98%80%EF%B8%8F%5BPatreon%20Comm%5D%5B7%5D.png?b=u){kind=link}
![Marvelous Mounds❗️[0].png](Marvelous%20Mounds%E2%9D%97%EF%B8%8F%5B0%5D.png?b=u){kind=link}
![Marvelous Mounds❗️[1].png](Marvelous%20Mounds%E2%9D%97%EF%B8%8F%5B1%5D.png?b=u){kind=link}
![Marvelous Mounds❗️[2].png](Marvelous%20Mounds%E2%9D%97%EF%B8%8F%5B2%5D.png?b=u){kind=link}
![Mary Sue's Exercises [Patreon Comm][0].png](Mary%20Sue%27s%20Exercises%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Mary Sue's Exercises [Patreon Comm][1].png](Mary%20Sue%27s%20Exercises%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![MatoSpectoru Zone [DISCORD] (English_Spanish).png](MatoSpectoru%20Zone%20%5BDISCORD%5D%20%28English_Spanish%29.png?b=u){kind=link}
![Megaera ❤️[Patreon Comm].png](Megaera%20%E2%9D%A4%EF%B8%8F%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Mewtwo - Pokemon - MFP8[0].png](Mewtwo%20-%20Pokemon%20-%20MFP8%5B0%5D.png?b=u){kind=link}
![Mewtwo - Pokemon - MFP8[1].png](Mewtwo%20-%20Pokemon%20-%20MFP8%5B1%5D.png?b=u){kind=link}
![Mewtwo - Pokemon - MFP8[2].png](Mewtwo%20-%20Pokemon%20-%20MFP8%5B2%5D.png?b=u){kind=link}
![Mewtwo - Pokemon - MFP8[3].png](Mewtwo%20-%20Pokemon%20-%20MFP8%5B3%5D.png?b=u){kind=link}
![Mewtwo - Pokemon - MFP8[4].gif](Mewtwo%20-%20Pokemon%20-%20MFP8%5B4%5D.gif?b=u){kind=link}
![Michelle [Comm][0].png](Michelle%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Michelle [Comm][1].png](Michelle%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Midna - Christmas Is Coming [Patreon Comm].png](Midna%20-%20Christmas%20Is%20Coming%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Midna - Dakimakura (Watermark) [Comm].png](Midna%20-%20Dakimakura%20%28Watermark%29%20%5BComm%5D.png?b=u){kind=link}
![Midna - Hyper Breasts [Patreon Comm].png](Midna%20-%20Hyper%20Breasts%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Midna - MFP N.4 (November)[0].png](Midna%20-%20MFP%20N.4%20%28November%29%5B0%5D.png?b=u){kind=link}
![Midna - MFP N.4 (November)[1].png](Midna%20-%20MFP%20N.4%20%28November%29%5B1%5D.png?b=u){kind=link}
![Midna - Tsuyu Asui's Outfit [Patreon Comm].png](Midna%20-%20Tsuyu%20Asui%27s%20Outfit%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Midna [Remake 2018].png](Midna%20%5BRemake%202018%5D.png?b=u){kind=link}
![Midna in Gerudo Desert [Comm].png](Midna%20in%20Gerudo%20Desert%20%5BComm%5D.png?b=u){kind=link}
![Midna new addiction [Part 1][0].png](Midna%20new%20addiction%20%5BPart%201%5D%5B0%5D.png?b=u){kind=link}
![Midna new addiction [Part 1][1].png](Midna%20new%20addiction%20%5BPart%201%5D%5B1%5D.png?b=u){kind=link}
![Midna new addiction [Part 1][2].png](Midna%20new%20addiction%20%5BPart%201%5D%5B2%5D.png?b=u){kind=link}
![Midna new addiction [Part 1][3].png](Midna%20new%20addiction%20%5BPart%201%5D%5B3%5D.png?b=u){kind=link}
![Midna new addiction [Part 1][4].png](Midna%20new%20addiction%20%5BPart%201%5D%5B4%5D.png?b=u){kind=link}
![Midna new addiction [Part 1][5].png](Midna%20new%20addiction%20%5BPart%201%5D%5B5%5D.png?b=u){kind=link}
![Midna new addiction [Part 2][0].png](Midna%20new%20addiction%20%5BPart%202%5D%5B0%5D.png?b=u){kind=link}
![Midna new addiction [Part 2][1].png](Midna%20new%20addiction%20%5BPart%202%5D%5B1%5D.png?b=u){kind=link}
![Midna new addiction [Part 2][2].png](Midna%20new%20addiction%20%5BPart%202%5D%5B2%5D.png?b=u){kind=link}
![Midna new addiction [Part 2][3].png](Midna%20new%20addiction%20%5BPart%202%5D%5B3%5D.png?b=u){kind=link}
![Midna new addiction [Part 2][4].png](Midna%20new%20addiction%20%5BPart%202%5D%5B4%5D.png?b=u){kind=link}
![Midna's Attributes 💓[0].png](Midna%27s%20Attributes%20%F0%9F%92%93%5B0%5D.png?b=u){kind=link}
![Midna's Attributes 💓[1].png](Midna%27s%20Attributes%20%F0%9F%92%93%5B1%5D.png?b=u){kind=link}
![Midna's Attributes 💓[2].png](Midna%27s%20Attributes%20%F0%9F%92%93%5B2%5D.png?b=u){kind=link}
![Midnah[0].png](Midnah%5B0%5D.png?b=u){kind=link}
![Midnah[1].png](Midnah%5B1%5D.png?b=u){kind=link}
![Midnah[2].png](Midnah%5B2%5D.png?b=u){kind=link}
![Midnah[3].png](Midnah%5B3%5D.png?b=u){kind=link}
![Midnah[4].png](Midnah%5B4%5D.png?b=u){kind=link}
![Midnah[5].png](Midnah%5B5%5D.png?b=u){kind=link}
![Midnah[6].png](Midnah%5B6%5D.png?b=u){kind=link}
![Midnass[0].png](Midnass%5B0%5D.png?b=u){kind=link}
![Midnass[1].png](Midnass%5B1%5D.png?b=u){kind=link}
![Mienshao's Training (1_2) [Comm][0].png](Mienshao%27s%20Training%20%281_2%29%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Mienshao's Training (1_2) [Comm][1].png](Mienshao%27s%20Training%20%281_2%29%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Mienshao's Training (1_2) [Comm][2].png](Mienshao%27s%20Training%20%281_2%29%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Mienshao's Training (2_2) [Comm][0].png](Mienshao%27s%20Training%20%282_2%29%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Mienshao's Training (2_2) [Comm][1].png](Mienshao%27s%20Training%20%282_2%29%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Millie Isis [Comm][0].png](Millie%20Isis%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Millie Isis [Comm][1].png](Millie%20Isis%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Mina Mongoose - Don't Keep Her Waiting 🎵 [Patreon Comm].png](Mina%20Mongoose%20-%20Don%27t%20Keep%20Her%20Waiting%20%F0%9F%8E%B5%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Mina Mongoose - Sound Trip 🎶 [Comm][0].png](Mina%20Mongoose%20-%20Sound%20Trip%20%F0%9F%8E%B6%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Mina Mongoose - Sound Trip 🎶 [Comm][1].png](Mina%20Mongoose%20-%20Sound%20Trip%20%F0%9F%8E%B6%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Mina Mongoose [Comm][0].png](Mina%20Mongoose%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Mina Mongoose [Comm][1].png](Mina%20Mongoose%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Mina Mongoose [Comm][2].png](Mina%20Mongoose%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Mina Mongoose [Comm][3].png](Mina%20Mongoose%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Mina's Backstage 🍑[0].png](Mina%27s%20Backstage%20%F0%9F%8D%91%5B0%5D.png?b=u){kind=link}
![Mina's Backstage 🍑[1].png](Mina%27s%20Backstage%20%F0%9F%8D%91%5B1%5D.png?b=u){kind=link}
![Mina's Backstage 🍑[2].png](Mina%27s%20Backstage%20%F0%9F%8D%91%5B2%5D.png?b=u){kind=link}
![Molly - Not Candy [Comm].png](Molly%20-%20Not%20Candy%20%5BComm%5D.png?b=u){kind=link}
![Molly - Special cargo [Comm][0].png](Molly%20-%20Special%20cargo%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Molly - Special cargo [Comm][1].png](Molly%20-%20Special%20cargo%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Molly - Special cargo [Comm][2].png](Molly%20-%20Special%20cargo%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Momo the Crasher [Comm].png](Momo%20the%20Crasher%20%5BComm%5D.png?b=u){kind=link}
![Mrs. Shy - Halloween Costume [Comm][0].png](Mrs.%20Shy%20-%20Halloween%20Costume%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Mrs. Shy - Halloween Costume [Comm][1].png](Mrs.%20Shy%20-%20Halloween%20Costume%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Mu-Shi X Frapter Bracllard [Patreon Comm][0].png](Mu-Shi%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Mu-Shi X Frapter Bracllard [Patreon Comm][1].png](Mu-Shi%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Mu-Shi X Karva Okada [Comm].png](Mu-Shi%20X%20Karva%20Okada%20%5BComm%5D.png?b=u){kind=link}
![Mu-Shi X Pan [Comm][0].png](Mu-Shi%20X%20Pan%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Mu-Shi X Pan [Comm][1].png](Mu-Shi%20X%20Pan%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Mu-Shi's "Full" Belly [Patreon Comm][0].png](Mu-Shi%27s%20%22Full%22%20Belly%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Mu-Shi's "Full" Belly [Patreon Comm][1].png](Mu-Shi%27s%20%22Full%22%20Belly%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Mu-Shi's Filling [Comm][0].png](Mu-Shi%27s%20Filling%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Mu-Shi's Filling [Comm][1].png](Mu-Shi%27s%20Filling%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Mu-Shi, Juicy Panda Booty [Patreon Comm].png](Mu-Shi%2C%20Juicy%20Panda%20Booty%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Muffet - Bust Style [Patreon Comm][0].png](Muffet%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Muffet - Bust Style [Patreon Comm][1].png](Muffet%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Muffet - Bust Style [Patreon Comm][2].png](Muffet%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Muffet - Bust Style [Patreon Comm][3].png](Muffet%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Muffet - Bust Style [Patreon Comm][4].png](Muffet%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B4%5D.png?b=u){kind=link}
![Muffet - Bust Style [Patreon Comm][5].png](Muffet%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B5%5D.png?b=u){kind=link}
![My OC Lei-Yin 2023 🐼💦[0].png](My%20OC%20Lei-Yin%202023%20%F0%9F%90%BC%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![My OC Lei-Yin 2023 🐼💦[1].png](My%20OC%20Lei-Yin%202023%20%F0%9F%90%BC%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![My OC Lei-Yin 2023 🐼💦[2].png](My%20OC%20Lei-Yin%202023%20%F0%9F%90%BC%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![My OCs (NSFW) [VOTE TIME][0].png](My%20OCs%20%28NSFW%29%20%5BVOTE%20TIME%5D%5B0%5D.png?b=u){kind=link}
![My OCs (NSFW) [VOTE TIME][1].png](My%20OCs%20%28NSFW%29%20%5BVOTE%20TIME%5D%5B1%5D.png?b=u){kind=link}
![My OCs (NSFW) [VOTE TIME][2].png](My%20OCs%20%28NSFW%29%20%5BVOTE%20TIME%5D%5B2%5D.png?b=u){kind=link}
![My OCs (NSFW) [VOTE TIME][3].png](My%20OCs%20%28NSFW%29%20%5BVOTE%20TIME%5D%5B3%5D.png?b=u){kind=link}
![My OCs (NSFW) [VOTE TIME][4].png](My%20OCs%20%28NSFW%29%20%5BVOTE%20TIME%5D%5B4%5D.png?b=u){kind=link}
![My OCs (NSFW) [VOTE TIME][5].png](My%20OCs%20%28NSFW%29%20%5BVOTE%20TIME%5D%5B5%5D.png?b=u){kind=link}
![My OCs (NSFW) [VOTE TIME][6].png](My%20OCs%20%28NSFW%29%20%5BVOTE%20TIME%5D%5B6%5D.png?b=u){kind=link}
![Naadia Lucario [Comm].png](Naadia%20Lucario%20%5BComm%5D.png?b=u){kind=link}
![Nebula [Comm][0].png](Nebula%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Nebula [Comm][1].png](Nebula%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Nebula [Comm][2].png](Nebula%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Nebula [Comm][3].png](Nebula%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Neeko - League of Legends[0].png](Neeko%20-%20League%20of%20Legends%5B0%5D.png?b=u){kind=link}
![Neeko - League of Legends[1].png](Neeko%20-%20League%20of%20Legends%5B1%5D.png?b=u){kind=link}
![Nemo - Magical Mishap 👀💦 [Comm].png](Nemo%20-%20Magical%20Mishap%20%F0%9F%91%80%F0%9F%92%A6%20%5BComm%5D.png?b=u){kind=link}
![New Submission[0].png](New%20Submission%5B0%5D.png?b=u){kind=link}
![New Submission[1].png](New%20Submission%5B1%5D.png?b=u){kind=link}
![New Submission[2].png](New%20Submission%5B2%5D.png?b=u){kind=link}
![New Yoga Position [Comm].png](New%20Yoga%20Position%20%5BComm%5D.png?b=u){kind=link}
![Niani Davis [Comm][0].png](Niani%20Davis%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Niani Davis [Comm][1].png](Niani%20Davis%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Nicole Watterson - A Good Day [Comm][0].png](Nicole%20Watterson%20-%20A%20Good%20Day%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Nicole Watterson - A Good Day [Comm][1].png](Nicole%20Watterson%20-%20A%20Good%20Day%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Nicole Watterson - A Good Day [Comm][2].png](Nicole%20Watterson%20-%20A%20Good%20Day%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Nicole Watterson - A Good Day [Comm][3].png](Nicole%20Watterson%20-%20A%20Good%20Day%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Nicole Watterson - A Good Day [Comm][4].png](Nicole%20Watterson%20-%20A%20Good%20Day%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Nicole Watterson - A Good Day [Comm][5].png](Nicole%20Watterson%20-%20A%20Good%20Day%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Nicole Watterson - A Good Day [Comm][6].png](Nicole%20Watterson%20-%20A%20Good%20Day%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![Nicole Watterson [Comm][0].png](Nicole%20Watterson%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Nicole Watterson [Comm][1].png](Nicole%20Watterson%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Nicole Watterson [Comm][2].png](Nicole%20Watterson%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Nicole Watterson [Patreon Comm][0].png](Nicole%20Watterson%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Nicole Watterson [Patreon Comm][1].png](Nicole%20Watterson%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Nicole Watterson x2 [Comm].png](Nicole%20Watterson%20x2%20%5BComm%5D.png?b=u){kind=link}
![Nicole [Comm][0].png](Nicole%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Nicole [Comm][1].png](Nicole%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Nicole [Comm][2].png](Nicole%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Nicole [Comm][3].png](Nicole%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Nila Stern X Frapter Bracllard [Patreon Comm][0].png](Nila%20Stern%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Nila Stern X Frapter Bracllard [Patreon Comm][1].png](Nila%20Stern%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Nila Stern swallowing the Mic [Patreon Comm][0].png](Nila%20Stern%20swallowing%20the%20Mic%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Nila Stern swallowing the Mic [Patreon Comm][1].png](Nila%20Stern%20swallowing%20the%20Mic%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Nila Stern swallowing the Mic [Patreon Comm][2].png](Nila%20Stern%20swallowing%20the%20Mic%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Nila Stern swallowing the Mic [Patreon Comm][3].png](Nila%20Stern%20swallowing%20the%20Mic%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Nila's Buttload 😏 [Patreon Comm].png](Nila%27s%20Buttload%20%F0%9F%98%8F%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Nila's Favorite Seat [Patreon Comm][0].png](Nila%27s%20Favorite%20Seat%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Nila's Favorite Seat [Patreon Comm][1].png](Nila%27s%20Favorite%20Seat%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Nya! Nippon Ichi! [Comm][0].png](Nya%21%20Nippon%20Ichi%21%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Nya! Nippon Ichi! [Comm][1].png](Nya%21%20Nippon%20Ichi%21%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Nya…I haven’t eaten yet… 😽[0].png](Nya%E2%80%A6I%20haven%E2%80%99t%20eaten%20yet%E2%80%A6%20%F0%9F%98%BD%5B0%5D.png?b=u){kind=link}
![Nya…I haven’t eaten yet… 😽[1].png](Nya%E2%80%A6I%20haven%E2%80%99t%20eaten%20yet%E2%80%A6%20%F0%9F%98%BD%5B1%5D.png?b=u){kind=link}
![Orange Lust [Comm][0].png](Orange%20Lust%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Orange Lust [Comm][1].png](Orange%20Lust%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Orange Lust [Comm][2].png](Orange%20Lust%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Orange Lust [Comm][3].png](Orange%20Lust%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Orange Lust [Comm][4].png](Orange%20Lust%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Orange Lust [Comm][5].png](Orange%20Lust%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Penny's New Form [Comm][0].png](Penny%27s%20New%20Form%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Penny's New Form [Comm][1].png](Penny%27s%20New%20Form%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Penny's New Form [Comm][2].png](Penny%27s%20New%20Form%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Penny's New Form [Comm][3].png](Penny%27s%20New%20Form%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Penny's New Form [Comm][4].png](Penny%27s%20New%20Form%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Penny's New Form [Comm][5].png](Penny%27s%20New%20Form%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Pepper - OC [Comm].png](Pepper%20-%20OC%20%5BComm%5D.png?b=u){kind=link}
![Peri. [Comm][0].png](Peri.%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Peri. [Comm][1].png](Peri.%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Peri. [Comm][2].png](Peri.%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Peri. [Comm][3].png](Peri.%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Petra [ArtTrade][0].png](Petra%20%5BArtTrade%5D%5B0%5D.png?b=u){kind=link}
![Petra [ArtTrade][1].png](Petra%20%5BArtTrade%5D%5B1%5D.png?b=u){kind=link}
![Pheromosa _ Inanna [Patreon Comm][0].png](Pheromosa%20_%20Inanna%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Pheromosa _ Inanna [Patreon Comm][1].png](Pheromosa%20_%20Inanna%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Pheromosa _ Inanna [Patreon Comm][2].png](Pheromosa%20_%20Inanna%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Pheromosa _ Inanna [Patreon Comm][3].png](Pheromosa%20_%20Inanna%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Pixxy X Moraka [Patreon Comm][0].png](Pixxy%20X%20Moraka%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Pixxy X Moraka [Patreon Comm][1].png](Pixxy%20X%20Moraka%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Pixxy X Moraka [Patreon Comm][2].png](Pixxy%20X%20Moraka%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Pixxy X Moraka [Patreon Comm][3].png](Pixxy%20X%20Moraka%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Poppy X Rai [Comm][0].png](Poppy%20X%20Rai%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Poppy X Rai [Comm][1].png](Poppy%20X%20Rai%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Poppy [FCS+ 2][0].png](Poppy%20%5BFCS%2B%202%5D%5B0%5D.png?b=u){kind=link}
![Poppy [FCS+ 2][1].png](Poppy%20%5BFCS%2B%202%5D%5B1%5D.png?b=u){kind=link}
![Portia Pierce [Comm].png](Portia%20Pierce%20%5BComm%5D.png?b=u){kind=link}
![Primarina - Tentacle Panic [Patreon Comm][0].png](Primarina%20-%20Tentacle%20Panic%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Primarina - Tentacle Panic [Patreon Comm][1].png](Primarina%20-%20Tentacle%20Panic%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Queen Alicia - Royal Booty [Patreon Comm].png](Queen%20Alicia%20-%20Royal%20Booty%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Raena Ass [Comm].png](Raena%20Ass%20%5BComm%5D.png?b=u){kind=link}
![Rai's thighs [Comm][0].png](Rai%27s%20thighs%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rai's thighs [Comm][1].png](Rai%27s%20thighs%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Raven BIG Leader 💜[0].png](Raven%20BIG%20Leader%20%F0%9F%92%9C%5B0%5D.png?b=u){kind=link}
![Raven BIG Leader 💜[1].png](Raven%20BIG%20Leader%20%F0%9F%92%9C%5B1%5D.png?b=u){kind=link}
![Raven BIG Leader 💜[2].png](Raven%20BIG%20Leader%20%F0%9F%92%9C%5B2%5D.png?b=u){kind=link}
![Ready for any duty [Comm][0].png](Ready%20for%20any%20duty%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Ready for any duty [Comm][10].png](Ready%20for%20any%20duty%20%5BComm%5D%5B10%5D.png?b=u){kind=link}
![Ready for any duty [Comm][11].png](Ready%20for%20any%20duty%20%5BComm%5D%5B11%5D.png?b=u){kind=link}
![Ready for any duty [Comm][1].png](Ready%20for%20any%20duty%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Ready for any duty [Comm][2].png](Ready%20for%20any%20duty%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Ready for any duty [Comm][3].png](Ready%20for%20any%20duty%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Ready for any duty [Comm][4].png](Ready%20for%20any%20duty%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Ready for any duty [Comm][5].png](Ready%20for%20any%20duty%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Ready for any duty [Comm][6].png](Ready%20for%20any%20duty%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![Ready for any duty [Comm][7].png](Ready%20for%20any%20duty%20%5BComm%5D%5B7%5D.png?b=u){kind=link}
![Ready for any duty [Comm][8].png](Ready%20for%20any%20duty%20%5BComm%5D%5B8%5D.png?b=u){kind=link}
![Ready for any duty [Comm][9].png](Ready%20for%20any%20duty%20%5BComm%5D%5B9%5D.png?b=u){kind=link}
![Ready to train (F)[0].png](Ready%20to%20train%20%28F%29%5B0%5D.png?b=u){kind=link}
![Ready to train (F)[1].png](Ready%20to%20train%20%28F%29%5B1%5D.png?b=u){kind=link}
![Ready to train (M)[0].png](Ready%20to%20train%20%28M%29%5B0%5D.png?b=u){kind=link}
![Ready to train (M)[1].png](Ready%20to%20train%20%28M%29%5B1%5D.png?b=u){kind=link}
![Rei Darkblade showing the goods [Comm][0].png](Rei%20Darkblade%20showing%20the%20goods%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rei Darkblade showing the goods [Comm][1].png](Rei%20Darkblade%20showing%20the%20goods%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Relaxing time with Ruby [Comm][0].png](Relaxing%20time%20with%20Ruby%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Relaxing time with Ruby [Comm][1].png](Relaxing%20time%20with%20Ruby%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Renabutt [Comm][0].png](Renabutt%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Renabutt [Comm][1].png](Renabutt%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Renabutt [Comm][2].png](Renabutt%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Renamon _ Cassandra [Comm][0].png](Renamon%20_%20Cassandra%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Renamon _ Cassandra [Comm][1].png](Renamon%20_%20Cassandra%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Renamon _ Cassandra [Comm][2].png](Renamon%20_%20Cassandra%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Renamon _ Cassandra [Comm][3].png](Renamon%20_%20Cassandra%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Renamon _ Cassandra [Comm][4].png](Renamon%20_%20Cassandra%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Renamon _ Cassandra [Comm][5].png](Renamon%20_%20Cassandra%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Renamon _ Cassandra [Comm][6].png](Renamon%20_%20Cassandra%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![Renamon _ Cassandra [Comm][7].png](Renamon%20_%20Cassandra%20%5BComm%5D%5B7%5D.png?b=u){kind=link}
![Renard [Comm].png](Renard%20%5BComm%5D.png?b=u){kind=link}
![Rena🍈🍈[0].png](Rena%F0%9F%8D%88%F0%9F%8D%88%5B0%5D.png?b=u){kind=link}
![Rena🍈🍈[1].png](Rena%F0%9F%8D%88%F0%9F%8D%88%5B1%5D.png?b=u){kind=link}
![Rena🍈🍈[2].png](Rena%F0%9F%8D%88%F0%9F%8D%88%5B2%5D.png?b=u){kind=link}
![Rena🍈🍈[3].png](Rena%F0%9F%8D%88%F0%9F%8D%88%5B3%5D.png?b=u){kind=link}
![Rich in sugars 2 🍬💦[0].png](Rich%20in%20sugars%202%20%F0%9F%8D%AC%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Rich in sugars 2 🍬💦[1].png](Rich%20in%20sugars%202%20%F0%9F%8D%AC%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Rivet's Cute [Comm][0].png](Rivet%27s%20Cute%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rivet's Cute [Comm][1].png](Rivet%27s%20Cute%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Rocket Love 2 [Comm][0].png](Rocket%20Love%202%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rocket Love 2 [Comm][1].png](Rocket%20Love%202%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Rocket Love 2 [Comm][2].png](Rocket%20Love%202%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Rocket Love 2 [Comm][3].png](Rocket%20Love%202%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Rocket Love 2 [Comm][4].png](Rocket%20Love%202%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Rocket Love 3 [Comm][0].png](Rocket%20Love%203%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rocket Love 3 [Comm][1].png](Rocket%20Love%203%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Rocket Love 3 [Comm][2].png](Rocket%20Love%203%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Rocket Love 3 [Comm][3].png](Rocket%20Love%203%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Rocket Love [Comm][0].png](Rocket%20Love%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rocket Love [Comm][1].png](Rocket%20Love%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Rocket Love [Comm][2].png](Rocket%20Love%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Rocket Love [Comm][3].png](Rocket%20Love%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Rocket Love [Comm][4].png](Rocket%20Love%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Roo - Cheeky Goblin [Comm][0].png](Roo%20-%20Cheeky%20Goblin%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Roo - Cheeky Goblin [Comm][1].png](Roo%20-%20Cheeky%20Goblin%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Roo - Cheeky Goblin [Comm][2].png](Roo%20-%20Cheeky%20Goblin%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Roo - Cheeky Goblin [Comm][3].png](Roo%20-%20Cheeky%20Goblin%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Rouge - Bat Tits Instead of Cake 👀💦 [Comm][0].png](Rouge%20-%20Bat%20Tits%20Instead%20of%20Cake%20%F0%9F%91%80%F0%9F%92%A6%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rouge - Bat Tits Instead of Cake 👀💦 [Comm][1].png](Rouge%20-%20Bat%20Tits%20Instead%20of%20Cake%20%F0%9F%91%80%F0%9F%92%A6%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Rouge - Bat Tits Instead of Cake 👀💦 [Comm][2].png](Rouge%20-%20Bat%20Tits%20Instead%20of%20Cake%20%F0%9F%91%80%F0%9F%92%A6%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Rouge - Bat Tits Instead of Cake 👀💦 [Comm][3].png](Rouge%20-%20Bat%20Tits%20Instead%20of%20Cake%20%F0%9F%91%80%F0%9F%92%A6%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Rouge 3D Mousepad [ON PRE-ORDER][0].png](Rouge%203D%20Mousepad%20%5BON%20PRE-ORDER%5D%5B0%5D.png?b=u){kind=link}
![Rouge 3D Mousepad [ON PRE-ORDER][1].png](Rouge%203D%20Mousepad%20%5BON%20PRE-ORDER%5D%5B1%5D.png?b=u){kind=link}
![Rouge 3D Mousepad [ON PRE-ORDER][2].png](Rouge%203D%20Mousepad%20%5BON%20PRE-ORDER%5D%5B2%5D.png?b=u){kind=link}
![Rouge X Knuckles X Shade [Comm][0].png](Rouge%20X%20Knuckles%20X%20Shade%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rouge X Knuckles X Shade [Comm][1].png](Rouge%20X%20Knuckles%20X%20Shade%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Rouge X Knuckles X Shade [Comm][2].png](Rouge%20X%20Knuckles%20X%20Shade%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Rouge X Shade 2 [Comm][0].png](Rouge%20X%20Shade%202%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rouge X Shade 2 [Comm][1].png](Rouge%20X%20Shade%202%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Rouge X Shade [Sketch] [Comm][0].png](Rouge%20X%20Shade%20%5BSketch%5D%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rouge X Shade [Sketch] [Comm][1].png](Rouge%20X%20Shade%20%5BSketch%5D%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Rouge X Shade [Sketch] [Comm][2].png](Rouge%20X%20Shade%20%5BSketch%5D%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Rouge X Shade [Sketch] [Comm][3].png](Rouge%20X%20Shade%20%5BSketch%5D%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Rouge X Zeena [Comm][0].png](Rouge%20X%20Zeena%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rouge X Zeena [Comm][1].png](Rouge%20X%20Zeena%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Rouge the Bat - MFP11[0].png](Rouge%20the%20Bat%20-%20MFP11%5B0%5D.png?b=u){kind=link}
![Rouge the Bat - MFP11[1].png](Rouge%20the%20Bat%20-%20MFP11%5B1%5D.png?b=u){kind=link}
![Rouge the Bat - MFP11[2].png](Rouge%20the%20Bat%20-%20MFP11%5B2%5D.png?b=u){kind=link}
![Rouge the Bat - MFP11[3].png](Rouge%20the%20Bat%20-%20MFP11%5B3%5D.png?b=u){kind=link}
![Rouge the Bat - Snoot [Comm][0].png](Rouge%20the%20Bat%20-%20Snoot%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rouge the Bat - Snoot [Comm][1].png](Rouge%20the%20Bat%20-%20Snoot%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Rouge's Problem [Comm][0].png](Rouge%27s%20Problem%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Rouge's Problem [Comm][1].png](Rouge%27s%20Problem%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Rouge's Problem [Comm][2].png](Rouge%27s%20Problem%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Rouge's Problem [Comm][3].png](Rouge%27s%20Problem%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Rouge’s Sexy Service 💞[0].png](Rouge%E2%80%99s%20Sexy%20Service%20%F0%9F%92%9E%5B0%5D.png?b=u){kind=link}
![Rouge’s Sexy Service 💞[1].png](Rouge%E2%80%99s%20Sexy%20Service%20%F0%9F%92%9E%5B1%5D.png?b=u){kind=link}
![Rouge’s Sexy Service 💞[2].png](Rouge%E2%80%99s%20Sexy%20Service%20%F0%9F%92%9E%5B2%5D.png?b=u){kind=link}
![Rouge’s Sexy Service 💞[3].png](Rouge%E2%80%99s%20Sexy%20Service%20%F0%9F%92%9E%5B3%5D.png?b=u){kind=link}
![Roxanne [Comm][0].png](Roxanne%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Roxanne [Comm][1].png](Roxanne%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Roxanne [Comm][2].png](Roxanne%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Sadie (OC) - Polecat Mom[0].png](Sadie%20%28OC%29%20-%20Polecat%20Mom%5B0%5D.png?b=u){kind=link}
![Sadie (OC) - Polecat Mom[1].png](Sadie%20%28OC%29%20-%20Polecat%20Mom%5B1%5D.png?b=u){kind=link}
![Saggita [Patreon Comm][0].png](Saggita%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Saggita [Patreon Comm][1].png](Saggita%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Saika X Miyako [Comm].png](Saika%20X%20Miyako%20%5BComm%5D.png?b=u){kind=link}
![Saki [Comm][0].png](Saki%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Saki [Comm][1].png](Saki%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Saki [Comm][2].png](Saki%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Saki [Comm][3].png](Saki%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Salazzle [Patreon Comm][0].png](Salazzle%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Salazzle [Patreon Comm][1].png](Salazzle%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Sally X Fiona [Comm][0].png](Sally%20X%20Fiona%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Sally X Fiona [Comm][1].png](Sally%20X%20Fiona%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Sasha X Frapter Bracllard [Patreon Comm][0].png](Sasha%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Sasha X Frapter Bracllard [Patreon Comm][1].png](Sasha%20X%20Frapter%20Bracllard%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Sayaka and Friends [Comm][0].png](Sayaka%20and%20Friends%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Sayaka and Friends [Comm][1].png](Sayaka%20and%20Friends%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Sayaka and Friends [Comm][2].png](Sayaka%20and%20Friends%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Sayaka and Friends [Comm][3].png](Sayaka%20and%20Friends%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Scormidna's Cake 💚[0].png](Scormidna%27s%20Cake%20%F0%9F%92%9A%5B0%5D.png?b=u){kind=link}
![Scormidna's Cake 💚[1].png](Scormidna%27s%20Cake%20%F0%9F%92%9A%5B1%5D.png?b=u){kind=link}
![Secretary Chitin - OC [Patreon Comm][0].png](Secretary%20Chitin%20-%20OC%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Secretary Chitin - OC [Patreon Comm][1].png](Secretary%20Chitin%20-%20OC%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Serenity [Comm][0].png](Serenity%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Serenity [Comm][1].png](Serenity%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Sexy Bird [Comm][0].png](Sexy%20Bird%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Sexy Bird [Comm][1].png](Sexy%20Bird%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Sexy Bird [Comm][2].png](Sexy%20Bird%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Sexy Bird [Comm][3].png](Sexy%20Bird%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Sexy Bird [Comm][4].png](Sexy%20Bird%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Sexy Bird [Comm][5].png](Sexy%20Bird%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Sexy Carmelita 🦊💦[0].png](Sexy%20Carmelita%20%F0%9F%A6%8A%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Sexy Carmelita 🦊💦[1].png](Sexy%20Carmelita%20%F0%9F%A6%8A%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Sexy Carmelita 🦊💦[2].png](Sexy%20Carmelita%20%F0%9F%A6%8A%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![Sexy Carmelita 🦊💦[3].png](Sexy%20Carmelita%20%F0%9F%A6%8A%F0%9F%92%A6%5B3%5D.png?b=u){kind=link}
![Sexy Carmelita 🦊💦[4].png](Sexy%20Carmelita%20%F0%9F%A6%8A%F0%9F%92%A6%5B4%5D.png?b=u){kind=link}
![Sharpevoir [Comm][0].png](Sharpevoir%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Sharpevoir [Comm][1].png](Sharpevoir%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Sharpevoir [Comm][2].png](Sharpevoir%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Sharpevoir [Comm][3].png](Sharpevoir%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Sharpevoir [Comm][4].png](Sharpevoir%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Sharpevoir [Comm][5].png](Sharpevoir%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![She has a BIG band [Comm][0].png](She%20has%20a%20BIG%20band%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![She has a BIG band [Comm][1].png](She%20has%20a%20BIG%20band%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![She has a BIG band [Comm][2].png](She%20has%20a%20BIG%20band%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![She has a BIG band [Comm][3].png](She%20has%20a%20BIG%20band%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![She has a BIG band [Comm][4].png](She%20has%20a%20BIG%20band%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![She has a BIG band [Comm][5].png](She%20has%20a%20BIG%20band%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![She has a BIG band [Comm][6].png](She%20has%20a%20BIG%20band%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![She has a BIG band [Comm][7].png](She%20has%20a%20BIG%20band%20%5BComm%5D%5B7%5D.png?b=u){kind=link}
![Shirina [Comm][0].png](Shirina%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Shirina [Comm][1].png](Shirina%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Shirina [Comm][2].png](Shirina%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Shirina [Comm][3].png](Shirina%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Skyla Flygon [Comm][0].png](Skyla%20Flygon%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Skyla Flygon [Comm][1].png](Skyla%20Flygon%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Solar Flare (OC)[0].png](Solar%20Flare%20%28OC%29%5B0%5D.png?b=u){kind=link}
![Solar Flare (OC)[1].png](Solar%20Flare%20%28OC%29%5B1%5D.png?b=u){kind=link}
![Solar Flare (OC)[2].png](Solar%20Flare%20%28OC%29%5B2%5D.png?b=u){kind=link}
![Sonic X Zooey [Comm].png](Sonic%20X%20Zooey%20%5BComm%5D.png?b=u){kind=link}
![Sonikko - Cow Suit [Patreon Comm][0].png](Sonikko%20-%20Cow%20Suit%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Sonikko - Cow Suit [Patreon Comm][1].png](Sonikko%20-%20Cow%20Suit%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Sonikko - Maid [Patreon Comm].png](Sonikko%20-%20Maid%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Sophie [Comm][0].png](Sophie%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Sophie [Comm][1].png](Sophie%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Soundbyte - Soft Pillows [Comm][0].png](Soundbyte%20-%20Soft%20Pillows%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Soundbyte - Soft Pillows [Comm][1].png](Soundbyte%20-%20Soft%20Pillows%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Staying UP all night! [Comm][0].png](Staying%20UP%20all%20night%21%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Staying UP all night! [Comm][1].png](Staying%20UP%20all%20night%21%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Staying UP all night! [Comm][2].png](Staying%20UP%20all%20night%21%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Sticking it in Sticks [Patreon Comm][0].png](Sticking%20it%20in%20Sticks%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Sticking it in Sticks [Patreon Comm][1].png](Sticking%20it%20in%20Sticks%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Sticking it in Sticks [Patreon Comm][2].png](Sticking%20it%20in%20Sticks%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Sticking it in Sticks [Patreon Comm][3].png](Sticking%20it%20in%20Sticks%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Sticking it in Sticks [Patreon Comm][4].png](Sticking%20it%20in%20Sticks%20%5BPatreon%20Comm%5D%5B4%5D.png?b=u){kind=link}
![Sticking it in Sticks [Patreon Comm][5].png](Sticking%20it%20in%20Sticks%20%5BPatreon%20Comm%5D%5B5%5D.png?b=u){kind=link}
![Sticks' Treat [Patreon Comm][0].png](Sticks%27%20Treat%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Sticks' Treat [Patreon Comm][1].png](Sticks%27%20Treat%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Sticks' Treat [Patreon Comm][2].png](Sticks%27%20Treat%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Strawberry [Patreon Comm].png](Strawberry%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Susie Booty 🍑[0].png](Susie%20Booty%20%F0%9F%8D%91%5B0%5D.png?b=u){kind=link}
![Susie Booty 🍑[1].png](Susie%20Booty%20%F0%9F%8D%91%5B1%5D.png?b=u){kind=link}
![Susie Booty 🍑[2].png](Susie%20Booty%20%F0%9F%8D%91%5B2%5D.png?b=u){kind=link}
![Susie Booty 🍑[3].png](Susie%20Booty%20%F0%9F%8D%91%5B3%5D.png?b=u){kind=link}
![Sweet Dreams 🌙💦[0].png](Sweet%20Dreams%20%F0%9F%8C%99%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Sweet Dreams 🌙💦[1].png](Sweet%20Dreams%20%F0%9F%8C%99%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Sweet Dreams 🌙💦[2].png](Sweet%20Dreams%20%F0%9F%8C%99%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![Sweet Dreams 🌙💦[3].png](Sweet%20Dreams%20%F0%9F%8C%99%F0%9F%92%A6%5B3%5D.png?b=u){kind=link}
![TXN [Comm].png](TXN%20%5BComm%5D.png?b=u){kind=link}
![Tails X Spring the Rabbit [Comm][0].png](Tails%20X%20Spring%20the%20Rabbit%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Tails X Spring the Rabbit [Comm][1].png](Tails%20X%20Spring%20the%20Rabbit%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Takeshi - Character Sheet [Comm].png](Takeshi%20-%20Character%20Sheet%20%5BComm%5D.png?b=u){kind=link}
![Takeshi X Lei-Yin [Comm][0].png](Takeshi%20X%20Lei-Yin%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Takeshi X Lei-Yin [Comm][1].png](Takeshi%20X%20Lei-Yin%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Taokaka is hungry 🤤[0].png](Taokaka%20is%20hungry%20%F0%9F%A4%A4%5B0%5D.png?b=u){kind=link}
![Taokaka is hungry 🤤[1].png](Taokaka%20is%20hungry%20%F0%9F%A4%A4%5B1%5D.png?b=u){kind=link}
![Taokaka is hungry 🤤[2].png](Taokaka%20is%20hungry%20%F0%9F%A4%A4%5B2%5D.png?b=u){kind=link}
![Tasty Pavita 💦[0].png](Tasty%20Pavita%20%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Tasty Pavita 💦[1].png](Tasty%20Pavita%20%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Tasty Pavita 💦[2].png](Tasty%20Pavita%20%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![Tell me more! ❤️[0].png](Tell%20me%20more%21%20%E2%9D%A4%EF%B8%8F%5B0%5D.png?b=u){kind=link}
![Tell me more! ❤️[1].png](Tell%20me%20more%21%20%E2%9D%A4%EF%B8%8F%5B1%5D.png?b=u){kind=link}
![Tell me more! ❤️[2].png](Tell%20me%20more%21%20%E2%9D%A4%EF%B8%8F%5B2%5D.png?b=u){kind=link}
![Tell me more! ❤️[3].png](Tell%20me%20more%21%20%E2%9D%A4%EF%B8%8F%5B3%5D.png?b=u){kind=link}
![Tell me more! ❤️[4].png](Tell%20me%20more%21%20%E2%9D%A4%EF%B8%8F%5B4%5D.png?b=u){kind=link}
![Tentacular! 🐙💦[0].png](Tentacular%21%20%F0%9F%90%99%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Tentacular! 🐙💦[1].png](Tentacular%21%20%F0%9F%90%99%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Tentacular! 🐙💦[2].png](Tentacular%21%20%F0%9F%90%99%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![Tentacular! 🐙💦[3].png](Tentacular%21%20%F0%9F%90%99%F0%9F%92%A6%5B3%5D.png?b=u){kind=link}
![Tersh 2 [Comm][0].png](Tersh%202%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Tersh 2 [Comm][1].png](Tersh%202%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Tersh 2 [Comm][2].png](Tersh%202%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![The Bunny Hop [Comm].png](The%20Bunny%20Hop%20%5BComm%5D.png?b=u){kind=link}
![The Milf Caresser [Comm][0].png](The%20Milf%20Caresser%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![The Milf Caresser [Comm][1].png](The%20Milf%20Caresser%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![The Milf Caresser [Comm][2].png](The%20Milf%20Caresser%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![The nurses will now see you~ 💉💦[0].png](The%20nurses%20will%20now%20see%20you~%20%F0%9F%92%89%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![The nurses will now see you~ 💉💦[1].png](The%20nurses%20will%20now%20see%20you~%20%F0%9F%92%89%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![The nurses will now see you~ 💉💦[2].png](The%20nurses%20will%20now%20see%20you~%20%F0%9F%92%89%F0%9F%92%A6%5B2%5D.png?b=u){kind=link}
![The pie is not ready yet 🥧[0].png](The%20pie%20is%20not%20ready%20yet%20%F0%9F%A5%A7%5B0%5D.png?b=u){kind=link}
![The pie is not ready yet 🥧[1].png](The%20pie%20is%20not%20ready%20yet%20%F0%9F%A5%A7%5B1%5D.png?b=u){kind=link}
![The pie is not ready yet 🥧[2].png](The%20pie%20is%20not%20ready%20yet%20%F0%9F%A5%A7%5B2%5D.png?b=u){kind=link}
![Thicc Mongoose Ass [Comm].png](Thicc%20Mongoose%20Ass%20%5BComm%5D.png?b=u){kind=link}
![Thicc Mongoose Booty [Comm][0].png](Thicc%20Mongoose%20Booty%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Thicc Mongoose Booty [Comm][1].png](Thicc%20Mongoose%20Booty%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Thicc Mongoose Booty [Comm][2].png](Thicc%20Mongoose%20Booty%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Thicc Mongoose Booty [Comm][3].png](Thicc%20Mongoose%20Booty%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Tiffany (Cow Transform) [Comm][0].png](Tiffany%20%28Cow%20Transform%29%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Tiffany (Cow Transform) [Comm][1].png](Tiffany%20%28Cow%20Transform%29%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Tigress [Comm][0].png](Tigress%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Tigress [Comm][1].png](Tigress%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Tigress [Comm][2].png](Tigress%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Tigress [Comm][3].png](Tigress%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Tikal's Ancient Ass [Comm].png](Tikal%27s%20Ancient%20Ass%20%5BComm%5D.png?b=u){kind=link}
![Time to enjoy on the Island~ 😎🏝️[0].png](Time%20to%20enjoy%20on%20the%20Island~%20%F0%9F%98%8E%F0%9F%8F%9D%EF%B8%8F%5B0%5D.png?b=u){kind=link}
![Time to enjoy on the Island~ 😎🏝️[1].png](Time%20to%20enjoy%20on%20the%20Island~%20%F0%9F%98%8E%F0%9F%8F%9D%EF%B8%8F%5B1%5D.png?b=u){kind=link}
![Time to enjoy on the Island~ 😎🏝️[2].png](Time%20to%20enjoy%20on%20the%20Island~%20%F0%9F%98%8E%F0%9F%8F%9D%EF%B8%8F%5B2%5D.png?b=u){kind=link}
![Time to enjoy on the Island~ 😎🏝️[3].png](Time%20to%20enjoy%20on%20the%20Island~%20%F0%9F%98%8E%F0%9F%8F%9D%EF%B8%8F%5B3%5D.png?b=u){kind=link}
![Time to enjoy on the Island~ 😎🏝️[4].png](Time%20to%20enjoy%20on%20the%20Island~%20%F0%9F%98%8E%F0%9F%8F%9D%EF%B8%8F%5B4%5D.png?b=u){kind=link}
![Time to enjoy on the Island~ 😎🏝️[5].png](Time%20to%20enjoy%20on%20the%20Island~%20%F0%9F%98%8E%F0%9F%8F%9D%EF%B8%8F%5B5%5D.png?b=u){kind=link}
![Time to enjoy on the Island~ 😎🏝️[6].png](Time%20to%20enjoy%20on%20the%20Island~%20%F0%9F%98%8E%F0%9F%8F%9D%EF%B8%8F%5B6%5D.png?b=u){kind=link}
![Time to enjoy on the Island~ 😎🏝️[7].png](Time%20to%20enjoy%20on%20the%20Island~%20%F0%9F%98%8E%F0%9F%8F%9D%EF%B8%8F%5B7%5D.png?b=u){kind=link}
![Toni [Comm].png](Toni%20%5BComm%5D.png?b=u){kind=link}
![Toriel - Ready to Cook [Comm][0].png](Toriel%20-%20Ready%20to%20Cook%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Toriel - Ready to Cook [Comm][1].png](Toriel%20-%20Ready%20to%20Cook%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Toriel - Ready to Cook [Comm][2].png](Toriel%20-%20Ready%20to%20Cook%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Toriel [Comm].png](Toriel%20%5BComm%5D.png?b=u){kind=link}
![Toriel 💓👀💦 [Patreon Comm].png](Toriel%20%F0%9F%92%93%F0%9F%91%80%F0%9F%92%A6%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Toriel's Pie [Comm][0].png](Toriel%27s%20Pie%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Toriel's Pie [Comm][1].png](Toriel%27s%20Pie%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Toriel's Pie [Comm][2].png](Toriel%27s%20Pie%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Toriel's Pie [Comm][3].png](Toriel%27s%20Pie%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Toriel's Pie [Comm][4].png](Toriel%27s%20Pie%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Trick or Treat[0].png](Trick%20or%20Treat%5B0%5D.png?b=u){kind=link}
![Trick or Treat[1].png](Trick%20or%20Treat%5B1%5D.png?b=u){kind=link}
![Trick or Treat[2].png](Trick%20or%20Treat%5B2%5D.png?b=u){kind=link}
![Trick or Treat[3].png](Trick%20or%20Treat%5B3%5D.png?b=u){kind=link}
![Trinity 2 [Comm][0].png](Trinity%202%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Trinity 2 [Comm][1].png](Trinity%202%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Trinity 2 [Comm][2].png](Trinity%202%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Trinity 2 [Comm][3].png](Trinity%202%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Trinity [Comm][0].png](Trinity%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Trinity [Comm][1].png](Trinity%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Trinity [Comm][2].png](Trinity%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Trinity [Comm][3].png](Trinity%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Tristana needs support[0].png](Tristana%20needs%20support%5B0%5D.png?b=u){kind=link}
![Tristana needs support[1].png](Tristana%20needs%20support%5B1%5D.png?b=u){kind=link}
![Tristana needs support[2].png](Tristana%20needs%20support%5B2%5D.png?b=u){kind=link}
![Tristana needs support[3].png](Tristana%20needs%20support%5B3%5D.png?b=u){kind=link}
![Tsukino[0].png](Tsukino%5B0%5D.png?b=u){kind=link}
![Tsukino[1].png](Tsukino%5B1%5D.png?b=u){kind=link}
![Tsukino[2].png](Tsukino%5B2%5D.png?b=u){kind=link}
![Tsukino[3].png](Tsukino%5B3%5D.png?b=u){kind=link}
![Tsukino[4].png](Tsukino%5B4%5D.png?b=u){kind=link}
![Twice the Delight 👀💦[0].png](Twice%20the%20Delight%20%F0%9F%91%80%F0%9F%92%A6%5B0%5D.png?b=u){kind=link}
![Twice the Delight 👀💦[1].png](Twice%20the%20Delight%20%F0%9F%91%80%F0%9F%92%A6%5B1%5D.png?b=u){kind=link}
![Umbra - Xmas [Comm][0].png](Umbra%20-%20Xmas%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Umbra - Xmas [Comm][1].png](Umbra%20-%20Xmas%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Umbra 4 - OC [Patreon Comm] (2_2)[0].png](Umbra%204%20-%20OC%20%5BPatreon%20Comm%5D%20%282_2%29%5B0%5D.png?b=u){kind=link}
![Umbra 4 - OC [Patreon Comm] (2_2)[1].png](Umbra%204%20-%20OC%20%5BPatreon%20Comm%5D%20%282_2%29%5B1%5D.png?b=u){kind=link}
![Umbra [Patreon Comm].png](Umbra%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Uzume Firethorn [Comm][0].png](Uzume%20Firethorn%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Uzume Firethorn [Comm][1].png](Uzume%20Firethorn%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Uzume Firethorn [Comm][2].png](Uzume%20Firethorn%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Uzume Firethorn [Comm][3].png](Uzume%20Firethorn%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Valkyrie - Pheromosa [Comm][0].png](Valkyrie%20-%20Pheromosa%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Valkyrie - Pheromosa [Comm][1].png](Valkyrie%20-%20Pheromosa%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Vampi [ArtTrade].png](Vampi%20%5BArtTrade%5D.png?b=u){kind=link}
![Verona - Xmas [Comm].png](Verona%20-%20Xmas%20%5BComm%5D.png?b=u){kind=link}
![Verona [Patreon Comm].png](Verona%20%5BPatreon%20Comm%5D.png?b=u){kind=link}
![Violet [Comm][0].png](Violet%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Violet [Comm][1].png](Violet%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Vivia [Patreon Comm][0].png](Vivia%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Vivia [Patreon Comm][1].png](Vivia%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Wanna Race? [Comm][0].png](Wanna%20Race%3F%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Wanna Race? [Comm][1].png](Wanna%20Race%3F%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Wanna Race? [Comm][2].png](Wanna%20Race%3F%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Who!?[0].png](Who%21%3F%5B0%5D.png?b=u){kind=link}
![Who!?[1].png](Who%21%3F%5B1%5D.png?b=u){kind=link}
![Who!?[2].png](Who%21%3F%5B2%5D.png?b=u){kind=link}
![Who!?[3].png](Who%21%3F%5B3%5D.png?b=u){kind=link}
![Who!?[4].png](Who%21%3F%5B4%5D.png?b=u){kind=link}
![Who!?[5].png](Who%21%3F%5B5%5D.png?b=u){kind=link}
![Who!?[6].png](Who%21%3F%5B6%5D.png?b=u){kind=link}
![Who!?[7].png](Who%21%3F%5B7%5D.png?b=u){kind=link}
![Whoa! Tawna![0].png](Whoa%21%20Tawna%21%5B0%5D.png?b=u){kind=link}
![Whoa! Tawna![1].png](Whoa%21%20Tawna%21%5B1%5D.png?b=u){kind=link}
![Whoa! Tawna![2].png](Whoa%21%20Tawna%21%5B2%5D.png?b=u){kind=link}
![Whoa! Tawna![3].png](Whoa%21%20Tawna%21%5B3%5D.png?b=u){kind=link}
![Whoa! Tawna![4].png](Whoa%21%20Tawna%21%5B4%5D.png?b=u){kind=link}
![With Aureli, size doesn't matter [Comm][0].png](With%20Aureli%2C%20size%20doesn%27t%20matter%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![With Aureli, size doesn't matter [Comm][1].png](With%20Aureli%2C%20size%20doesn%27t%20matter%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![With Aureli, size doesn't matter [Comm][2].png](With%20Aureli%2C%20size%20doesn%27t%20matter%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![With Aureli, size doesn't matter [Comm][3].png](With%20Aureli%2C%20size%20doesn%27t%20matter%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![With Aureli, size doesn't matter [Comm][4].png](With%20Aureli%2C%20size%20doesn%27t%20matter%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Woomy ne! [Comm][0].png](Woomy%20ne%21%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Woomy ne! [Comm][1].png](Woomy%20ne%21%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Woomy ne! [Comm][2].png](Woomy%20ne%21%20%5BComm%5D%5B2%5D.png?b=u){kind=link}
![Woomy ne! [Comm][3].png](Woomy%20ne%21%20%5BComm%5D%5B3%5D.png?b=u){kind=link}
![Woomy ne! [Comm][4].png](Woomy%20ne%21%20%5BComm%5D%5B4%5D.png?b=u){kind=link}
![Woomy ne! [Comm][5].png](Woomy%20ne%21%20%5BComm%5D%5B5%5D.png?b=u){kind=link}
![Woomy ne! [Comm][6].png](Woomy%20ne%21%20%5BComm%5D%5B6%5D.png?b=u){kind=link}
![Woomy ne! [Comm][7].png](Woomy%20ne%21%20%5BComm%5D%5B7%5D.png?b=u){kind=link}
![Woomy ne! [Comm][8].png](Woomy%20ne%21%20%5BComm%5D%5B8%5D.png?b=u){kind=link}
![Xyphyth [Comm][0].png](Xyphyth%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Xyphyth [Comm][1].png](Xyphyth%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Yeah, Rouge, she's sexy and smooth.. 🎵[0].png](Yeah%2C%20Rouge%2C%20she%27s%20sexy%20and%20smooth..%20%F0%9F%8E%B5%5B0%5D.png?b=u){kind=link}
![Yeah, Rouge, she's sexy and smooth.. 🎵[1].png](Yeah%2C%20Rouge%2C%20she%27s%20sexy%20and%20smooth..%20%F0%9F%8E%B5%5B1%5D.png?b=u){kind=link}
![Yeah, Rouge, she's sexy and smooth.. 🎵[2].png](Yeah%2C%20Rouge%2C%20she%27s%20sexy%20and%20smooth..%20%F0%9F%8E%B5%5B2%5D.png?b=u){kind=link}
![Yoga Deerling [Comm][0].png](Yoga%20Deerling%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Yoga Deerling [Comm][1].png](Yoga%20Deerling%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Yordle's Time~🍩 [Comm].png](Yordle%27s%20Time~%F0%9F%8D%A9%20%5BComm%5D.png?b=u){kind=link}
![Zoey [Comm][0].png](Zoey%20%5BComm%5D%5B0%5D.png?b=u){kind=link}
![Zoey [Comm][1].png](Zoey%20%5BComm%5D%5B1%5D.png?b=u){kind=link}
![Zoroark - Bust Style [Patreon Comm][0].png](Zoroark%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B0%5D.png?b=u){kind=link}
![Zoroark - Bust Style [Patreon Comm][1].png](Zoroark%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B1%5D.png?b=u){kind=link}
![Zoroark - Bust Style [Patreon Comm][2].png](Zoroark%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B2%5D.png?b=u){kind=link}
![Zoroark - Bust Style [Patreon Comm][3].png](Zoroark%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B3%5D.png?b=u){kind=link}
![Zoroark - Bust Style [Patreon Comm][4].png](Zoroark%20-%20Bust%20Style%20%5BPatreon%20Comm%5D%5B4%5D.png?b=u){kind=link}